Motorola Solutions 99FT3083 MOTOTRBO VHF 25 W Mobile Radio User Manual 96C72 B

Motorola Solutions, Inc. MOTOTRBO VHF 25 W Mobile Radio 96C72 B

UserManual.wiki >

Motorola Solutions >

99FT3083 User Manual >

Exhibit 8B User Manual

Contents

1. Exhibit 8A User Manual
2. Exhibit 8B User Manual

Exhibit 8B User Manual

izTitle Page XPR 4300/4350/4500/4550 Mobile Radio Installation Manual Motorola, Inc. 8000 West Sunrise Boulevard Fort Lauderdale, Florida 33322 6816812H01

iiiInstallation Requirements for Compliance withRadio Frequency (RF) Energy Exposure Safety StandardsATTENTION!This radio is intended for use in occupational/controlled conditions, where users have full knowledge of their exposure and can exercise control over their exposure to meet FCC limits. This radio device is NOT authorized for general population, consumer, or any other use.To ensure compliance to RF Energy Safety Standards:• Install only Motorola approved antennas and accessories• Be sure that antenna installation is per “Antenna Installation,” on page 2-8 of this manual• Be sure that Product Safety and RF Safety Booklet enclosed with this radio is available to the end user upon completion of the installation of this radio Before using this product, the operator must be familiar with the RF energy awareness information and operating instructions in the Product Safety and RF Exposure booklet enclosed with each radio (Motorola Publication part number 68P81095C99) to ensure compliance with Radio Frequency (RF) energy exposure limits. For a list of Motorola-approved antennas and other accessories, visit the following web site which lists approved accessories for your radio model: http://www.motorola.com/governmentandenterprise.

This Page Intentionally Left Blankiv

Table of Contents v6816812H01 March 23, 2006Table of ContentsForeword.........................................................................................................iiProduct Safety and RF Exposure Compliance............................................................................................iiManual Revisions ........................................................................................................................................iiParts Ordering .............................................................................................................................................iiComputer Software Copyrights ...................................................................................................................iiDocument Copyrights..................................................................................................................................iiDisclaimer....................................................................................................................................................iiTrademarks .................................................................................................................................................iiInstallation Requirements for Compliance with Radio Frequency (RF) Energy Exposure Safety Standards......................iiiMobile Radio Model Numbering Scheme..................................................viiiCommercial Warranty ...................................................................................ixLimited Warranty ........................................................................................................................................ixMOTOROLA COMMUNICATION PRODUCTS................................................................................ixI. What This Warranty Covers And For How Long .....................................................................ixII. General Provisions .................................................................................................................ixIII. State Law Rights ....................................................................................................................xIV. How To Get Warranty Service ...............................................................................................xV. What This Warranty Does Not Cover......................................................................................xVI. Patent And Software Provisions ...........................................................................................xiVII. Governing Law.....................................................................................................................xiChapter 1 Introduction ......................................................................... 1-11.1 Mobile Radio Description............................................................................................................... 1-11.1.1 Dimensions ....................................................................................................................... 1-11.2.1 Dash Mount Configuration ................................................................................................ 1-21.3 Base/Control Stations .................................................................................................................... 1-21.4 Tools Required for XPR 4300/4350/4500/4550 Installations......................................................... 1-3Chapter 2 Standard Configurations.................................................... 2-12.1 Planning the Installation................................................................................................................. 2-12.2 Radio Mounting.............................................................................................................................. 2-42.2.2 Locking Kit (Optional) ....................................................................................................... 2-62.2.2.1 All Radios................................................................................................................. 2-62.3 Power Cable .................................................................................................................................. 2-62.4 Ignition Sense Cable...................................................................................................................... 2-82.5 Antenna Installation ....................................................................................................................... 2-82.5.1 Selecting an Antenna Site/Location on a Metal Body Vehicle .......................................... 2-82.5.2 Mini-UHF Connection ....................................................................................................... 2-92.6 Speaker ...................................................................................................................................... 2-102.7 Microphone Hang-Up Clip ........................................................................................................... 2-12

vi Table of ContentsMarch 23, 2006 6816812H012.7.1 Standard Hang-Up Clip................................................................................................... 2-122.7.2 Handheld Hang-Up Box.................................................................................................. 2-122.8 Completing the Installation .......................................................................................................... 2-12Chapter 3 Options and Accessories Installation ............................... 3-13.1 Emergency Pushbutton, Footswitch, Horn Relay, and Light Relay Installation............................. 3-13.1.1 Emergency Pushbutton or Footswitch Installation............................................................ 3-13.1.2 Horn (External Alarm) Relay Installation........................................................................... 3-13.1.3 Lights (External Alarm) Relay Installation......................................................................... 3-13.2 Dash-Mount Accessory Installation ............................................................................................... 3-13.2.1 MDC Emergency Pushbutton or Footswitch Installation................................................... 3-23.2.2 Horn and Lights (External Alarm) Relay ........................................................................... 3-3Appendix A Replacement Parts Ordering..............................................A-1A.1 Basic Ordering Information............................................................................................................A-1A.2 Motorola Online .............................................................................................................................A-1A.3 Mail Orders .................................................................................................................................... A-1A.5 Fax Orders.....................................................................................................................................A-2A.6 Parts Identification .........................................................................................................................A-2A.7 Product Customer Service.............................................................................................................A-2Glossary .........................................................................................Glossary-1Index .....................................................................................................Index-1Related PublicationsXPR 4300/4350/4500/4550 Digital Mobile Radio Basic Service Manual .................................... 6816816H01

List of Figures vii6816812H01 March 23, 2006List of FiguresFigure 1-1. Front View of Dash Mount Transceiver Trunnion.................................................................. 1-1Figure 1-2. Side View of Dash Mount Transceiver Trunnion................................................................... 1-1Figure 1-3. Dash Mount Configuration .................................................................................................... 1-2Figure 1-4. Remote Mount Configuration, with 110W transceiver........................................................... 1-2Figure 2-1. Mounting Flexibility in Middle Console.................................................................................. 2-1Figure 2-2. On Top or Under Dash Mounting .......................................................................................... 2-1Figure 2-3. Radio Installation (Dash Mount) with Transceiver................................................................. 2-2Figure 2-4. Pin Configuration .................................................................................................................. 2-3Figure 2-5. Trunnion Orientation ............................................................................................................. 2-4Figure 2-6. Transmission Hump Trunnion Mounting ............................................................................... 2-5Figure 2-7. Below Dash Trunnion Mounting............................................................................................ 2-5Figure 2-8. Locking Kit (Optional) 110W Radios ..................................................................................... 2-6Figure 2-9. Cabling Interconnect Diagram for Dash Mount..................................................................... 2-7Figure 2-30. Mini-UHF Connection (as shown on mid-power) .................................................................. 2-9Figure 2-31. Mini-UHF Connector Tool (as shown on mid-power) .......................................................... 2-10Figure 2-32. Speaker Mounting............................................................................................................... 2-11Figure 3-1. VIP Connector Detail ............................................................................................................ 3-1Figure 3-2. Emergency Switch Wiring Diagram ......................................................................................3-2Figure 3-3. Horn/Light Wiring Diagram.................................................................................................... 3-3List of TablesTable 3-1. Rear Accessory Jack Pin Functions .....................................................................................3-4

March 23, 2006 6816812H01viii Mobile Radio Model Numbering Scheme Mobile Radio Model Numbering SchemePosition 1 - Type of UnitM = MobilePositions 2 & 3 - Model SeriesPosition 4 - Frequency Band136 to 174MHz403 to 470MHz450 to 527MHzPosition 5 - Power Level1-25 Watts25-40 Watt25-45 WattPosition 6 - Physical PackagesLow TierMid TierHigh TierRepeaterPosition 7 - Channel Spacing9 = Variable/ProgrammableTypical Model Number:Position:Position 8 - Primary OperationWithout GPSWith GPSPosition 9 - Primary System TypeConventionalPosition 10 - Feature Level1 = Mini-U2 = BNC3 = Wall Mount5 = Desktop7 = Rack MountPosition 11 - VersionVersion LetterPosition 12 - Unique Model VariationsN = North America (Standard Package)123 4 56 7 8 9101112MAZ 2 7 Q P H 9 L A 1 A NModel - XPR SeriesJQT===NPQ ===C HNR====J L==A =

6816812H01 March 23, 2006Commercial Warranty ixCommercial WarrantyLimited WarrantyMOTOROLA COMMUNICATION PRODUCTSI. What This Warranty Covers And For How LongMOTOROLA INC. (“MOTOROLA”) warrants the MOTOROLA manufactured Communication Products listed below (“Product”) against defects in material and workmanship under normal use and service for a period of time from the date of purchase as scheduled below:Motorola, at its option, will at no charge either repair the Product (with new or reconditioned parts), replace it (with a new or reconditioned Product), or refund the purchase price of the Product during the warranty period provided it is returned in accordance with the terms of this warranty. Replaced parts or boards are warranted for the balance of the original applicable warranty period. All replaced parts of Product shall become the property of MOTOROLA.This express limited warranty is extended by MOTOROLA to the original end user purchaser only and is not assignable or transferable to any other party. This is the complete warranty for the Product manufactured by MOTOROLA. MOTOROLA assumes no obligations or liability for additions or modifications to this warranty unless made in writing and signed by an officer of MOTOROLA. Unless made in a separate agreement between MOTOROLA and the original end user purchaser, MOTOROLA does not warrant the installation, maintenance or service of the Product.MOTOROLA cannot be responsible in any way for any ancillary equipment not furnished by MOTOROLA which is attached to or used in connection with the Product, or for operation of the Product with any ancillary equipment, and all such equipment is expressly excluded from this warranty. Because each system which may use the Product is unique, MOTOROLA disclaims liability for range, coverage, or operation of the system as a whole under this warranty.II. General ProvisionsThis warranty sets forth the full extent of MOTOROLA'S responsibilities regarding the Product. Repair, replacement or refund of the purchase price, at MOTOROLA's option, is the exclusive remedy. THIS WARRANTY IS GIVEN IN LIEU OF ALL OTHER EXPRESS WARRANTIES. IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, ARE LIMITED TO THE DURATION OF THIS LIMITED WARRANTY. IN NO EVENT SHALL MOTOROLA BE LIABLE FOR DAMAGES IN EXCESS OF THE PURCHASE PRICE OF THE PRODUCT, FOR ANY LOSS OF USE, LOSS OF TIME, INCONVENIENCE, COMMERCIAL LOSS, LOST PROFITS OR SAVINGS OR OTHER INCIDENTAL, SPECIAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE SUCH PRODUCT, TO THE FULL EXTENT SUCH MAY BE DISCLAIMED BY LAW.XPR 4300/4350/4500/4550 Mobile Radio Two (2) YearProduct Accessories One (1) Year

March 23, 2006 6816812H01xCommercial Warranty III. State Law RightsSOME STATES DO NOT ALLOW THE EXCLUSION OR LIMITATION OF INCIDENTAL OR CONSEQUENTIAL DAMAGES OR LIMITATION ON HOW LONG AN IMPLIED WARRANTY LASTS, SO THE ABOVE LIMITATION OR EXCLUSIONS MAY NOT APPLY.This warranty gives specific legal rights, and there may be other rights which may vary from state to state.IV. How To Get Warranty ServiceYou must provide proof of purchase (bearing the date of purchase and Product item serial number) in order to receive warranty service and, also, deliver or send the Product item, transportation and insurance prepaid, to an authorized warranty service location. Warranty service will be provided by Motorola through one of its authorized warranty service locations. If you first contact the company which sold you the Product, it can facilitate your obtaining warranty service. You can also call Motorola at 1-888-567-7347 US/Canada.V. What This Warranty Does Not CoverA. Defects or damage resulting from use of the Product in other than its normal and customary manner.B. Defects or damage from misuse, accident, water, or neglect.C. Defects or damage from improper testing, operation, maintenance, installation, alteration, modification, or adjustment.D. Breakage or damage to antennas unless caused directly by defects in material workmanship.E. A Product subjected to unauthorized Product modifications, disassemblies or repairs (includ-ing, without limitation, the addition to the Product of non-Motorola supplied equipment) which adversely affect performance of the Product or interfere with Motorola's normal warranty inspection and testing of the Product to verify any warranty claim.F. Product which has had the serial number removed or made illegible.G. Rechargeable batteries if:- any of the seals on the battery enclosure of cells are broken or show evidence of tamper-ing.- the damage or defect is caused by charging or using the battery in equipment or service other than the Product for which it is specified.H. Freight costs to the repair depot.I. A Product which, due to illegal or unauthorized alteration of the software/firmware in the Prod-uct, does not function in accordance with MOTOROLA’s published specifications or the FCC type acceptance labeling in effect for the Product at the time the Product was initially distrib-uted from MOTOROLA.J. Scratches or other cosmetic damage to Product surfaces that does not affect the operation of the Product.K. Normal and customary wear and tear.

6816812H01 March 23, 2006Commercial Warranty xiVI. Patent And Software ProvisionsMOTOROLA will defend, at its own expense, any suit brought against the end user purchaser to the extent that it is based on a claim that the Product or parts infringe a United States patent, and MOTOROLA will pay those costs and damages finally awarded against the end user purchaser in any such suit which are attributable to any such claim, but such defense and payments are conditioned on the following:A. that MOTOROLA will be notified promptly in writing by such purchaser of any notice of such claim;B. that MOTOROLA will have sole control of the defense of such suit and all negotiations for its settlement or compromise; andC. should the Product or parts become, or in MOTOROLA's opinion be likely to become, the subject of a claim of infringement of a United States patent, that such purchaser will permit MOTOROLA, at its option and expense, either to procure for such purchaser the right to con-tinue using the Product or parts or to replace or modify the same so that it becomes nonin-fringing or to grant such purchaser a credit for the Product or parts as depreciated and accept its return. The depreciation will be an equal amount per year over the lifetime of the Product or parts as established by MOTOROLA.MOTOROLA will have no liability with respect to any claim of patent infringement which is based upon the combination of the Product or parts furnished hereunder with software, apparatus or devices not furnished by MOTOROLA, nor will MOTOROLA have any liability for the use of ancillary equipment or software not furnished by MOTOROLA which is attached to or used in connection with the Product. The foregoing states the entire liability of MOTOROLA with respect to infringement of patents by the Product or any parts thereof.Laws in the United States and other countries preserve for MOTOROLA certain exclusive rights for copyrighted MOTOROLA software such as the exclusive rights to reproduce in copies and distribute copies of such Motorola software. MOTOROLA software may be used in only the Product in which the software was originally embodied and such software in such Product may not be replaced, copied, distributed, modified in any way, or used to produce any derivative thereof. No other use including, without limitation, alteration, modification, reproduction, distribution, or reverse engineering of such MOTOROLA software or exercise of rights in such MOTOROLA software is permitted. No license is granted by implication, estoppel or otherwise under MOTOROLA patent rights or copyrights.VII. Governing LawThis Warranty is governed by the laws of the State of Illinois, USA.

March 23, 2006 6816812H01xii Commercial Warranty Notes

Chapter 1 IntroductionThis manual covers the installation procedures for XPR 4300/4350/4500/4550 mobile and motorcycle radios with O5 control heads and accessories required to complete the radio system. The radio system consists of a control head, radio, antenna, microphone, speaker, cabling, and accessories.1.1 Mobile Radio Description1.1.1 DimensionsFigure 1-1 and Figure 1-2 show the basic dimensions of the dash mount transceiver trunnion XPR 4300/4350/4500/4550. The transceiver portion of a remote mount is sized similarly. When installing the radio, make sure to plan the installation carefully and leave additional room in the rear of the radio for cabling and accessory connections; in the front of the radio for access, controls, and cabling; and to the sides of the radio so that you may access and install the trunnion wing screws.NOTE: The rear accessory connector adds 0.75 in. to the overall length.Figure 1-1. Front View of Dash Mount Transceiver Trunnion Figure 1-2. Side View of Dash Mount Transceiver Trunnion8.5"7.1"9.69.12"3.5

March 23, 2006 6816812H011-2 Introduction: Standard Configurations1.2 Standard Configurations1.2.1 Dash Mount ConfigurationIn the dash mounting version of the XPR 4300/4350/4500/4550, the control head is mounted on the front of the transceiver housing. Electrical connection between the two takes place within the radio via a flexible circuit board between the connectors on the front of the transceiver and at the back of the control head.Figure 1-3. Dash Mount ConfigurationFor details on this configuration, see Section 2.2.1 on page 2-5.NOTE:Figure 1-4. Remote Mount Configuration, with 110W transceiverFor details on these configurations, see Section 2.2.2 on page 2-8.1.3 Base/Control StationsIf mobile radio equipment is installed at a fixed location and operated as a control station or as a fixed unit, the antenna installation must comply with the following requirements in order to ensure optimal performance and compliance with the RF energy exposure limits in the standards and guidelines listed in the 68P81095C99 manual:• The antenna should be mounted outside the building on the roof or a tower if at all possible.• As with all fixed site antenna installations, it is the responsibility of the licensee to manage the site in accordance with applicable regulatory requirements and may require additional compli-ance actions such as site survey measurements, signage, and site access restrictions in order to ensure that exposure limits are not exceeded.

6816812H01 March 23, 2006Introduction: Tools Required for XPR 4300/4350/4500/4550 Installations 1-31.4 Tools Required for XPR 4300/4350/4500/4550 InstallationsTool Part Number11/32 hex driver —RF cable tool HLN6695_Regular slot screwdriver of Phillips #2—Pin removal tool 6680163F011/4 hex driver —

March 23, 2006 6816812H01This Page Is Intentionally Left Blank1-4 Introduction

Chapter 2 Standard Configurations2.1 Planning the InstallationThe XPR 4300/4350/4500/4550 radio operates only in negative ground electrical systems. Before starting the radio installation, make sure that the ground polarity of the vehicle is correct. Accidentally reversing the polarity will not damage the radio, but will cause the cable fuses to blow.Planning is the key to fast, easy radio installation. Before starting the installation, inspect the vehicle and determine how and where you intend to mount the antenna, radio, and accessories. Plan wire and cable runs to provide maximum protection from inching, crushing, and overheating.2.1.1 Installation ExamplesYour mobile two-way radio offers various methods of installation, including dash or remote mount. Except for 110W radios, all versions of the XPR 4300/4350/4500/4550 can be either dash or remote mounted (see Figure 2-1 through Figure 2-2). CAUTION Before installing any electrical equipment, check the vehicle manufacturer’s user manual. The installation of this device should be completed by an authorized servicer or installer.Figure 2-1. Mounting Flexibility in Middle Console Figure 2-2. On Top or Under Dash Mounting RadioAntenna1/4-WavelengthBatterySpeakerRadioAntenna1/4-WavelengthBatterySpeakerRadio

March 23, 2006 6816812H012-2 Standard Configurations: Planning the Installation2.1.2 Wiring DiagramsFigure 2-3 shows the wiring diagrams for all the possible configurations. The title under each figure identifies the O5 control head configurations. Identify which of these figures shows the configuration that you are installing, and use the diagram when planning the installation.Figure 2-3. Radio Installation (Dash Mount) with Transceiver(For complete pin configuration, see Figure 2-4.)BATTERYHORN RELAYLIGHT RELAYMICCLIPSPEAKERMICEMERGENCYSWITCHFUSEFUSEBLOCK(+)(-)RED LEADFUSEFIREWALLHOLEMOUNTINGSCREWCONTROL HEADANTENNA CONNECTION ANTENNAIGNITION CABLEP2(SEE J2PINOUT)DCPOWER CABLETRUNNION

6816812H01 March 23, 2006Standard Configurations: Planning the Installation 2-3Figure 2-4. Pin Configuration

6816812H01 March 23, 2006Standard Configurations: Radio Mounting 2-52.2.1 Dash Mount with Trunnion1. Select the location to mount your radio on the transmission hump (see Figure 2-6) or under the dash (see Figure 2-7). When mounting the trunnion on the transmission hump take care the transmission housing is not affected.2. Using the trunnion mounting bracket as a template, mark the positions of the holes on the mounting surface. Use the innermost four holes for a curved mounting surface such as the transmission hump, and the four outmost holes for a flat surface such as under the dash.3. Center punch the spots you have marked and realign the trunnion in position.4. Secure the trunnion mounting bracket with the four self-drilling screws provided (see Figure 2-6 and Figure 2-7).5. Ensure that the plastic guides are aligned (horizontal) to the grooves of the trunnion. Slide the radio into the grooves until it snaps into place (see Figure 2-6). Secure the radio with the two wing screws provided.Figure 2-6. Transmission Hump Trunnion MountingFigure 2-7. Below Dash Trunnion MountingTabsTrunnionGrooveWing ScrewWing Screw Plastic GuidesThreaded Holefor Wing ScrewTrunnionWing ScrewWing ScrewHoles forMicrophoneS-Hook

March 23, 2006 6816812H012-6 Standard Configurations: Power Cable2.2.2 Locking Kit (Optional)2.2.2.1 All Radios If an optional locking kit is used (shown in Figure 2-8), position the lock bottom housing on the trunnion before installing the radio mounting screws. Then slip the top lock housing on and remove the key. You can install the lock on either side of the radio, and by rotating it 180°, you can also install it on dash installations.Figure 2-8. Locking Kit (Optional) 110W Radios2.3 Power CableRoute the red radio power cable from the radio to the vehicle’s battery compartment, using accepted industry methods and standards. Be sure to grommet the firewall hole to protect the cable. Remove the 15-amp (part number 6580283E06), 20-amp (part number 6580283E07) or 30-amp (for 110W) fuse from the fuseholder and connect the red lead of the radio power cable to the positive battery terminal using the hardware provided as shown in Figure 2-9. Connect the black lead to a convenient solid chassis ground point. DO NOT connect the black lead directly to the battery’s negative terminal.ExistingMountingScrewLockLockHousingRLN4779_ Locking KitMAEPF-28266-O

6816812H01 March 23, 2006Standard Configurations: Power Cable 2-7RADIO COMPARTMENT = OPERATOR COMPARTMENT VEHICLE BATTERYCOMPARTMENTA good chassis connection via the black primary power cable is essential for radio operation and to prevent damage to the radio and cable kit. Connection to the vehicle frame is desirable.VEHICLE BATTERY15A OR 20AFUSEPART OFVEHICLEWIRINGVEHICLEIGNITION SWITCHON/ACCGROMMETRADIO POWER CABLE(RED/BATTERY HOT)RADIO IGNITIONCABLE (thin RED)SPEAKER3A OR 4A FUSEMICROPHONERADIO POWER CABLE (BLK/GROUND)RADIO(-)(+)CAUTIONMAEPF-27646-ORear connectorCH SEE NOTENOTE:Caution: if you choose to connect the radio’s IGNITION line directly to the car’s battery, excess use of the radio when the car’s ignition is not running (i.e. alternator running) could result in a slow discharge of the car’s battery. This configuration allows the radio to operate with the car’s ignition switch ON or OFF.If the radio’s IGNITION line is wired to the car’s ignition switch, the radio will only function when the car’s ignition switch is turned ON.Figure 2-9. Cabling Interconnect Diagram for Dash Mount

March 23, 2006 6816812H012-8 Standard Configurations: Ignition Sense Cable2.4 Ignition Sense CableMotorola supplies an ignition sense cable and recommends that it be used with every mobile installation. The ignition sense cable allows the radio to be turned on and off with the vehicle ignition switch, and allows the radio to “remember” the state of the radio on/off switch, even if it is changed while the vehicle is off. • For radio ON/OFF control independent of the ignition switch, connect the red ignition cable (yel-low for remote) (pin 25 of accessory connector) to “battery hot” at the vehicle fuse block (dash mount only).• For radio ON/OFF control via the ignition switch, connect the red ignition cable (yellow for remote) to “ignition” at the fuse block.Note that for remote mount installations, the red and yellow leads are connected, not the red lead from the rear of the radio.The ignition sense cable uses either a 3-amp (P/N 6580283E01) or 4-amp (P/N 6580283E02) fuse.For other considerations when connecting the ignition cable, see the Basic Service Manual (Motorola publication part number 6881096C73).2.5 Antenna InstallationIMPORTANT NOTE: To assure optimum performance and compliance with RF Energy Safety standards, these antenna installation guidelines and instructions are limited to metal-body vehicles with appropriate ground planes and take into account the potential exposure of back seat passengers and bystanders outside the vehicle. NOTE: For mobile radios with rated power of 7 watts or less, the only installation restrictions are to use only Motorola approved antennas and install the antenna externally on metal body vehicles. For mobile radios with rated power greater than 7 Watts, always adhere to all the guidelines and restrictions in section 2.5.1 below. 2.5.1 Selecting an Antenna Site/Location on a Metal Body Vehicle1. External installation – Check the requirements of the antenna supplier and install the vehicle antenna external to a metal body vehicle in accordance with those requirements.2. Roof top – For optimum performance and compliance with RF Energy Safety standards, mount the antenna in the center area of the roof. 3. Trunk lid – On some vehicles with clearly defined, flat trunk lids, the antennas of some radio models (see restrictions below) can also be mounted on the center area of the trunk lid. For vehicles without clearly defined, flat trunk lids (such as hatchback autos, sport uitility vehicles, and pick-up trucks), mount the antenna in the center area of the roof. Before installing an antenna on the trunk lid, - Be sure that the distance from the antenna location on the trunk lid will be at least 85 cm (33 inches) from the front surface of the rear seat-back to assure compliance with RF Energy Safety standards.- Ensure that the trunk lid is grounded by connecting grounding straps between the trunk lid and the vehicle chassis.IF THESE CONDITIONS CANNOT BE SATISFIED, THEN MOUNT THE ANTENNA ON THE ROOF TOP!

6816812H01 March 23, 2006Standard Configurations: Antenna Installation 2-94. Mounting restrictions for certain radio models For 40 Watt UHF models, the 1/4 wave antenna should be mounted only in the center area of the roof, not on the trunk lid, to assure compliance with RF Energy Safety standards.5. Ensure that the antenna cable can be easily routed to the radio. Route the antenna cable as far away as possible from any vehicle electronic control units and associated wiring.6. Check the antenna location for any electrical interference.7. Ensure that any other mobile radio antenna on this vehicle is at least one foot (30.48 cm) away from this antenna.NOTE: Any two metal pieces rubbing against each other (such as seat springs, shift levers, trunk and hood lids, exhaust pipes, etc.) in close proximity to the antenna can cause severe receiver interference.2.5.2 Mini-UHF ConnectionTo ensure a secure connection of an antenna cable's mini-UHF plug to a radio's mini-UHF jack, their interlocking features must be properly engaged. If they are not properly engaged, the system will loosen. Using a tool (pliers or wrench) will not overcome a poor engagement, and is not recommended. NOTE: Applying excessive force with a tool can cause damage to the antenna or the connector (e.g., stripping threads, deforming the collar or connector, or causing the connector to twist in the housing opening and break).The mini-UHF connector tool (Motorola part number HLN6695_) is designed to securely tighten the antenna plug–radio jack connection without damaging either the plug or the jack.Motorola recommends the following sequence to ensure proper attachment of the system (see Figure 2-30):Figure 2-30. Mini-UHF Connection (as shown on mid-power)1. Make sure that there is sufficient slack in the antenna cable.2. Make sure that the collar of the antenna cable plug is loose and does not bind.3. Make sure that the mini-UHF jack is tight in the radio housing.4. Slide the collar back against the flange. Insert the antenna cable plug’s pin fully into the radio jack, but do not engage the threads.5. Ensure that the plug’s and jack’s interlocking features are fully seated. Check this by grasping the crimp on the cable jack, rotating the cable, and noting any movement. If the features are seated correctly, there should be NO movement.6. Finger-tighten the antenna cable plug’s collar onto the radio’s jack.Coax ConductorPlug (Pin)FlangeCableCollar PulledBack to FlangeMini UHFJack

March 23, 2006 6816812H012-10 Standard Configurations: Speaker7. Give a final tug, by hand, to the collar, and retighten by hand as firmly as possible.8. Slip the mini-UHF connector tool over the coaxial cable, using the gap between the tool’s legs (see Figure 2-31). Then, slide the tool up onto the plug’s knurled collar. Squeeze the two straight legs of the tool firmly together between your thumb and index finger and turn clockwise (as shown) to tighten the collar. It should take 1/4 turn or less. When you feel the tool slipping on the collar, the connection has been properly tightened. The tool can also be used to loosen a tight collar.NOTE: DO NOT use pliers or any other device to grip the tightening tool. It has been designed to allow you to achieve the proper torque on the collar without overtightening. Overtightening the collar can damage the connector and the radio.Figure 2-31. Mini-UHF Connector Tool (as shown on mid-power)2.6 Speaker The speaker kit includes a trunnion bracket that allows the speaker to be mounted in a variety of ways. With the trunnion bracket, the speaker can mount permanently on the dashboard or in accessible firewall areas. The trunnion allows the speaker to tilt for best operation. Mount the speaker out of the way so that it will not be kicked or knocked around by the vehicle occupants. Mount the speaker as follows:1. Use the speaker mounting bracket as a template to mark the mounting hole locations.2. Use the self-drilling screws provided to fasten the trunnion.3. Attach the speaker and fasten to the trunnion with two wing screws.4. Route the speaker wires under the carpet or floor covering, or behind the kick panels. Be sure the wires are out of the way and will not be snagged and broken by the occupants of the vehicle.CAUTION: DO NOT ground the radio's speaker leads. This system has a floating speaker output (dc voltage on both leads); damage to the audio circuit will result if either lead is grounded or if they are shorted together.(1) SqueezeFirmly TogetherHLN6695_(2)Tighten!C a u t i o n

6816812H01 March 23, 2006Standard Configurations: Speaker 2-11Figure 2-32. Speaker MountingDashboardFirewallTrunnionBracketORMAEPF-25764-O

March 23, 2006 6816812H012-12 Standard Configurations: Microphone Hang-Up Clip2.7 Microphone Hang-Up Clip 2.7.1 Standard Hang-Up ClipThe hang-up clip must be within reach of the operator(s). Measure this distance before actually mounting the bracket. Since the bracket has a positive-detent action, the microphone can be mounted in any position. The microphone hang-up clip must be grounded.Use the hang-up clip as a template to locate the mounting holes. To avoid interference when removing the microphone, install the flathead screw in the top clip hole.2.7.2 Handheld Hang-Up BoxUse the hang-up box (HUB) as a template to locate the mounting holes. Be sure the HUB will be within easy reach of the operator. Route the control wire with the male pin to the accessory cable connector at the rear of the radio or cable harness as shown in Figure 2-3. Open the accessory cable connector and connect the HUB control wire to location 3 of the accessory connector. Connect the other control wire from the HUB to a convenient solid chassis ground point.2.8 Completing the InstallationComplete the installation by connecting the speaker and power wires and plugging in the microphone cable/handheld control unit. Be sure to connect the microphone S-hook to the holes in the trunnion provided (see Figure 2-7) for strain relief (this is not applicable for 110W radios).

Chapter 3 Options and Accessories Installation3.1 Emergency Pushbutton, Footswitch, Horn Relay, and Light Relay Installation Perform the following installation procedure:1. Select an appropriate place to mount the option or accessory hardware.2. Route the accessory-to-control head cables under floor coverings or behind panels so that the vehicle occupants do not snag or break the wires.3. Attach wires from the accessory to the appropriate wire on the VIP cable. (see Table 3-1 and Table 3-2). Figure 3-1 shows how wires are plugged into the connector and how to use an extraction tool to remove wires.Figure 3-1. VIP Connector Detail3.1.1 Emergency Pushbutton or Footswitch InstallationMount the switch using the hardware that comes with the kit. Connect the emergency switch wires to a ground pin and a VIP IN pin on the VIP connector.3.1.2 Horn (External Alarm) Relay InstallationMount the horn relay in a suitable location (normally under the dash). Connect the relay contacts across the horn ring switch, typically found in the steering column. Connect the two control wires to a SW B+ pin and a VIP OUT pin on the VIP connector.3.1.3 Lights (External Alarm) Relay InstallationMount the light relay in a suitable location (normally under the dash). Connect the relay contacts across the headlamp ON/OFF switch. Connect the two control wires to a SW B+ pin and a VIP OUT pin on the VIP connector. 3.2 Dash-Mount Accessory InstallationFor dash-mounted configurations, the accessories must be installed through the accessory connector assembly that is located on the rear of the radio, adjacent to the power connector. Motorola-approved accessories are supplied with male terminals crimped to a 20-gauge wire specifically designed to fit the plug of the accessory connector assembly.

March 23, 2006 6816812H013-2 Options and Accessories Installation: Dash-Mount Accessory InstallationInsert the male terminal into the accessory connector assembly in the appropriate location and connect the accessory connector assembly in the rear accessory port (see Figure 3-8). Do not use other generic terminals in the plug. Generic terminals can cause electrical intermittencies and may cause damage to the plug.3.2.1 MDC Emergency Pushbutton or Footswitch Installation Mount the footswitch using the hardware that comes with the kit. Open the accessory cable connector housing; remove the jumper wire. Connect the emergency switch wires to pins 23 and 18 (see Figure 3-2). Close the connector housing; route the finished cable from the switch location to the control head location.NOTE: The emergency footswitch should be attached with A+ unattached. A+ should be attached after succesfully securing the screws in the connector. Figure 3-2. Emergency Switch Wiring Diagram ACCESSORIESCONNECTORPIN 23PIN 18NOTE 1SPST NORMALLY CLOSEDEMERGENCY SWITCHNOTE 1: REMOVE BLACK JUMPER WIRE INSIDE ACCESSORY CONNECTOR HOUSING. INSERT WIRES FROM EMERGENCY SWITCH1234567891011121314151617181920212223242524D+VbusAPM 2 (1-wire)SW B+Spkr-Tx AudioAux Audio Out 1 / RxD Aux Audio Out 2 / TxD GP5_1 (PTT)GP5_2 (Monitor)GP5_3 (Chan Act)Emerg SwIgn SenseD-USB / APM GroundAPM 1 (1-wire)Power GroundSpkr+Audio GroundRx AudioGroundGroundGP5_6GP5_7GP5_8VIP_1 (Ext Alarm)

6816812H01 March 23, 2006Options and Accessories Installation: Dash-Mount Accessory Installation 3-33.2.2 Horn and Lights (External Alarm) RelayFor installations that use the horn/lights option, select a suitable location for mounting (normally under the dash) and, referring to Figure 3-3, perform the following procedure:1. Horn Relay—Connect the relay contacts across the horn ring switch, typically found in the steering column. Open the accessory cable connector and connect the two control wires (male pins) into locations 26 and 7 of the connector.2. Lights Relay—Connect the relay across the headlamp ON/OFF switch, typically found in the steering column. Open the accessory cable connector and connect the two control wires (male pins) into locations 26 and 7 of the accessory connector.Figure 3-3. Horn/Light Wiring Diagram 3. Squeeze the covers together bending the wires in the strain-relief features. You may need a pair of pliers to seat the assembly covers. 4. Once the covers are fully seated, fasten them with the cover screws. Tighten the screws firmly but do not over-tighten them. Be sure none of the wires are pinched. 5. Reattach the accessory connector assembly to the back of the radio and fasten it by finger-tightening the jackscrews to prevent any loosening. CONNECTACROSS HORNRING SWITCHAND/OR HEAD LAMP SWITCHSPSTN.O.RELAY12V COILVIP OUT 1SWB+ACCESSORIESCONNECTORPIN 26PIN 71234567891011121314151617181920212223242524D+VbusAPM 2 (1-wire)SW B+Spkr-Tx AudioAux Audio Out 1 / RxD Aux Audio Out 2 / TxD GP5_1 (PTT)GP5_2 (Monitor)GP5_3 (Chan Act)Emerg SwIgn SenseD-USB / APM GroundAPM 1 (1-wire)Power GroundSpkr+Audio GroundRx AudioGroundGroundGP5_6GP5_7GP5_8VIP_1 (Ext Alarm)

March 23, 2006 6816812H013-4 Options and Accessories Installation: Dash-Mount Accessory Installation1This pin must be connected to ground by jumper on accessory cable if emergency is disabled, even if disabled by CPS. If enabled, this line must be grounded via a switch, which is normally closed. The emergency debounce time is programmable via CPS.2Pulling this line to ground will activate PTT function, activating the AUX_MIC input.3Fixed level (independent of volume level) received audio signal, including alert tones. Flat or de-emphasis are pro-grammed by CPS. Output voltage is approximately 100 mVrms per 1kHz of deviation. The DC offset is 1.4V.4This output is used to detect when a rear microphone accessory is taken off-hook, to override PL to alert the user to busy traffic prior to transmitting.5This microphone signal is independent of the microphone signal on the front microphone connector. The nominal input level is 80mVrms for 60% deviation when used for motorcycle, but can also support 300 mVrms for future APCO accessories. The DC impedance is 660 ohms and the AC impedance is 560 ohms.6See Table 2-1 in Chapter 2 for wiring options.Note: Please see the XPR 4300/4350/4500/4550 Basic Service manual (Motorola publication part number 6816816H01) for more detailed descriptions of these pins. Table 3-1. Rear Accessory Jack Pin Functions Pin No. Pin Name Pin Function Pin No. Pin Name Pin Function1USB+ USB + (Data) 14 Rx Audio Receive Live Audio 32USB- USB - (Data) 15 AUX Audio 2 PUBLIC Address 213VBUS USB Power (5V from USB accessory/cable)16 GND Ground4USB GND USB/APM Ground 17 GPS-1(PTT) 5V Level GPIO, PTT Input25 APM2 One Wire Data 18 GND Ground6 APM1 One Wire Data 19 GPS-2(Monitor) 5V Level GPIO, Monitor Input7SW B+ Switched Battery Voltage 20 GPS-6 5V Level GPIO8PWRGND Ground 21 GPS-3 5V Level GPIO, Channel Activity Function9SPKR- Speaker - (3.2 ohm minimum impedance)22 GPS-7 5V Level GPIO10 SPKR+ Speaker + (3.2 ohm minimum impedance)23 EMERGENCY Emergency Switch Input 111 Tx Audio Rear External Microphone Input524 GPS-7 5V Level GPIO12 Audio GND Audio Ground 25 IGN SENSE Ignition Sense613 AUX Audio 1 PUBLIC Address 1 26 VIP-1 12V Tolerant, 5V GPIO, External Alarm

Appendix A Replacement Parts OrderingA.1 Basic Ordering InformationWhen ordering replacement parts or equipment information, the complete identification number should be included. This applies to all components, kits, and chassis. If the component part number is not known, the order should include the number of the chassis or kit of which it is a part, and sufficient description of the desired component to identify it.Crystal orders should specify the crystal type number, crystal and carrier frequency, and the model number in which the part is used.The XPR 4300/4350/4500/4550 Digital Mobile Radio Basic Service Manual (Motorola publication part number 6816816H01) includes complete parts lists and parts numbers.A.2 Motorola OnlineMotorola Online users can access our online catalog athttps://www.motorola.com/businessonlineTo register for online access:• Domestic customers: please call 800-814-0601 (U.S. and Canada).• International customers: please go to https://www.motorola.com/businessonline and click on “Sign Up Now.”A.3 Mail OrdersSend written orders to the following addresses:Replacement Parts/ Test Equipment/Manuals/ Crystal Service Items:Motorola Inc.Radio Products and Services Division*Attention: Order Processing2200 Galvin DriveElgin, IL 60123U.S.A.Federal Government Orders:Motorola Inc.U.S. Federal Government Markets DivisionAttention: Order Processing7230 Parkway DriveLandover, MD 21076U.S.A.International Orders:Motorola Inc.Radio Products and Services Division*Attention: Order Processing2200 Galvin DriveElgin, IL 60123U.S.A.

March 23, 2006 6816812H01A-2 Replacement Parts Ordering: Telephone OrdersA.4 Telephone OrdersRadio Products and Services Division* (United States and Canada) 7:00 AM to 7:00 PM (Central Standard Time) Monday through Friday (Chicago, U.S.A.) 1-800-422-4210 1-847-538-8023 (International Orders)U.S. Federal Government Markets Division (USFGMD) 1-800-826-1913 Federal Government Parts - Credit Cards Only 8:30 AM to 5:00 PM (Eastern Standard Time)A.5 Fax OrdersRadio Products and Services Division* (United States and Canada) 1-800-622-6210 1-847-576-3023 (International)USFGMD (Federal Government Orders) 1-800-526-8641 (For Parts and Equipment Purchase Orders)A.6 Parts IdentificationRadio Products and Services Division* (United States and Canada) 1-800-422-4210, menu 3A.7 Product Customer ServiceCustomer Response Center (Non-technical Issues) 1-800-247-2346 FAX:1-800-247-2347*The Radio Products and Services Division (RPSD) was formerly known as the Customer Care and Services Division (CCSD) and/or the Accessories and Aftermarket Division (AAD).

Glossary GlossaryThis glossary contains an alphabetical listing of terms and their definitions that are applicable to ASTRO portable and mobile subscriber radio products.Term DefinitionA/D See analog-to-digital conversion.Abacus IC A custom integrated circuit providing a digital receiver intermediate frequency (IF) backend.ADC See analog-to-digital converter.ADDAG See Analog-to-Digital, Digital-to-Analog and Glue.ALC See automatic level control.analog Refers to a continuously variable signal or a circuit or device designed to handle such signals. See also digital.Analog-to-Digital, Digital-to-Analog and GlueAn integrated circuit designed to be an interface between the radio’s DSP, which is digital, and the analog transmitter and receiver ICs.analog-to-digital conversionConversion of an instantaneous dc voltage level to a corresponding digital value. See also D/A.analog-to-digital converterA device that converts analog signals into digital data. See also DAC.automatic level controlA circuit in the transmit RF path that controls RF power amplifier output, provides leveling over frequency and voltage, and protects against high VSWR.band Frequencies allowed for a specific purpose.BBP See baseband interface port.baseband interface portSynchronous serial interface to the transceiver board used to transfer transmit and receive audio data.BGA See ball grid array.ball grid array A type of IC package characterized by solder balls arranged in a grid that are located on the underside of the package.CODEC See coder/decoder.coder/decoder A device that encodes or decodes a signal.

March 23, 2006 6816812H01Glossary-2CPS See Customer Programming Software.Customer Programming SoftwareSoftware with a graphical user interface containing the feature set of an ASTRO radio. D/A See digital-to-analog conversion.DAC See digital-to-analog converter.default A pre-defined set of parameters.digital Refers to data that is stored or transmitted as a sequence of discrete symbols from a finite set; most commonly this means binary data represented using electronic or electromagnetic signals. See also analog.digital-to-analog conversionConversion of a digital signal to a voltage that is proportional to the input value. See also A/D.digital-to-analog converterA device that converts digital data into analog signals. See also ADC.Digital Private-Line A type of digital communications that utilizes privacy call, as well as memory channel and busy channel lock out to enhance communication efficiency.digital signal processorA microcontroller specifically designed for performing the mathematics involved in manipulating analog information, such as sound, that has been converted into a digital form. DSP also implies the use of a data compression technique.digital signal processor codeObject code executed by the Digital Signal Processor in an ASTRO subscriber radio. The DSP is responsible for computation-intensive tasks, such as decoding ASTRO signaling.DPL See Digital Private-Line. See also PL.DSP See digital signal processor.DSP code See digital signal processor code.DTE Data terminal equipment: i.e., a computer.DTMF See dual tone multi-frequency.dual tone multi-frequencyThe system used by touch-tone telephones. DTMF assigns a specific frequency, or tone, to each key so that it can easily be identified by a microprocessor.FCC Federal Communications Commission.Term Definition

6816812H01 March 23, 2006Glossary-3firmware Code executed by an embedded processor such as the Host or DSP in a subscriber radio. This type of code is typically resident in non-volatile memory and as such is more difficult to change than code executed from RAM.FGU See frequency generation unit.flash A non-volatile memory device similar to an EEPROM. Flash memory can be erased and reprogrammed in blocks instead of one byte at a time.frequency Number of times a complete electromagnetic-wave cycle occurs in a fixed unit of time (usually one second).frequency generation unitThis unit generates ultra-stable, low-phase noise master clock and other derived synchronization clocks that are distributed throughout the communication network.General-Purpose Input/OutputPins whose function is programmable.GPIO See General-Purpose Input/Output.host code Object code executed by the host processor in an ASTRO subscriber radio. The host is responsible for control-oriented tasks such as decoding and responding to user inputs.IC See integrated circuit.IF Intermediate Frequency.inbound signaling wordData transmitted on the control channel from a subscriber unit to the central control unit.integrated circuit An assembly of interconnected components on a small semiconductor chip, usually made of silicon. One chip can contain millions of microscopic components and perform many functions.ISW See inbound signaling word.kHz See kilohertz.kilohertz One thousand cycles per second. Used especially as a radio-frequency unit.LCD See liquid-crystal display.LED See light emitting diode.light emitting diode An electronic device that lights up when electricity is passed through it.liquid-crystal display An LCD uses two sheets of polarizing material with a liquid-crystal solution between them. An electric current passed through the liquid causes the crystals to align so that light cannot pass through them.Term Definition

March 23, 2006 6816812H01Glossary-4LO Local oscillator.low-speed handshake150-baud digital data sent to the radio during trunked operation while receiving audio.LSH See low-speed handshake.Master In Slave Out SPI data line from a peripheral to the MCU.Master Out Slave In SPI data line from the MCU to a peripheral.MCU See microcontroller unit.MDC Motorola Digital Communications.MDI MCU/DSP Interface internal to the Patriot IC.MHz See Megahertz.Megahertz One million cycles per second. Used especially as a radio-frequency unit. microcontroller unit Also written as µC. A microprocessor that contains RAM and ROM components, as well as communications and programming components and peripherals.MISO See Master In Slave Out.MOSI See Master Out Slave In.multiplexer An electronic device that combines several signals for transmission on some shared medium (e.g., a telephone wire).MUX See multiplexer.NiCd Nickel-cadmium.NiMH Nickel-metal-hydride.OMPAC See over-molded pad-array carrier.open architecture A controller configuration that utilizes a microprocessor with extended ROM, RAM, and EEPROM.oscillator An electronic device that produces alternating electric current and commonly employs tuned circuits and amplifying components.OSW See outbound signaling word.OTAR See over-the-air rekeying.outbound signaling wordData transmitted on the control channel from the central controller to the subscriber unit.over-molded pad-array carrierA Motorola custom IC package, distinguished by the presence of solder balls on the bottom pads.Term Definition

6816812H01 March 23, 2006Glossary-5over-the-air rekeying Allows the dispatcher to remotely reprogram the encryption keys in the radio.PA Power amplifier.paging One-way communication that alerts the receiver to retrieve a message.Patriot IC A dual-core processor that contains an MCU and a DSP in one IC package.PC Board Printed Circuit Board. Also referred to as a PCB.phase-locked loop A circuit in which an oscillator is kept in phase with a reference, usually after passing through a frequency divider.PL See private-line tone squelch.PLL See phase-locked loop.private-line tone squelchA continuous sub-audible tone that is transmitted along with the carrier. See also DPL.Programmable Read-Only MemoryA memory chip on which data can be written only once. Once data has been written onto a PROM, it remains there forever.programming cable A cable that allows the CPS to communicate directly with the radio using RS232.PROM See Programmable Read-Only Memory.PTT See Push-to-Talk.Push-to-Talk The switch or button usually located on the left side of the radio which, when pressed, causes the radio to transmit. When the PTT is released, the unit returns to receive operation.radio frequency The portion of the electromagnetic spectrum between audio sound and infrared light (approximately 10 kHz to 10 GHz).radio frequency power amplifierAmplifier having one or more active devices to amplify radio signals.Radio Service SoftwareNot used with XTL 5000. See Customer Programming Software.RAM See random access memory.random access memoryA type of computer memory that can be accessed randomly; that is, any byte of memory can be accessed without touching the preceding bytes.read-only memory A type of computer memory on which data has been prerecorded. Once data has been written onto a ROM chip, it cannot be removed and can only be read.Term Definition

March 23, 2006 6816812H01Glossary-6real-time clock A module that keeps track of elapsed time even when a computer is turned off.receiver Electronic device that amplifies RF signals. A receiver separates the audio signal from the RF carrier, amplifies it, and converts it back to the original sound waves.registers Short-term data-storage circuits within the microcontroller unit or programmable logic IC.repeater Remote transmit/receive facility that re-transmits received signals in order to improve communications range and coverage (conventional operation).repeater/talkaround A conventional radio feature that permits communication through a receive/transmit facility, which re-transmits received signals in order to improve communication range and coverage.RESET Reset line: an input to the microcontroller that restarts execution.RF See radio frequency.RF PA See radio frequency power amplifier.ROM See read-only memory.RPCIC Regulator/power control IC.RPT/TA See repeater/talkaround.RS232 A common interface standard for data communications equipment.RSS See Radio Service Software.RTC See real-time clock.RX Receive.RX DATA Recovered digital data line.SAP See Serial Audio CODEC Port.SCI IN Serial Communications Interface Input line.Serial Audio CODEC PortSSI to and from the GCAP II IC CODEC used to transfer transmit and receive audio data.Serial Communication Interface Input LineA full-duplex (receiver/transmitter) asynchronous serial interface.SCI IN See Serial Communication Interface Input Line.Serial Peripheral InterfaceHow the microcontroller communicates to modules and ICs through the CLOCK and DATA lines.Term Definition

6816812H01 March 23, 2006Glossary-7signal An electrically transmitted electromagnetic wave.Signal Qualifier modeAn operating mode in which the radio is muted, but still continues to analyze receive data to determine RX signal type.softpot See software potentiometer.software Computer programs, procedures, rules, documentation, and data pertaining to the operation of a system.software potentiometerA computer-adjustable electronic attenuator.spectrum Frequency range within which radiation has specific characteristics.SPI See Serial Peripheral Interface.squelch Muting of audio circuits when received signal levels fall below a pre-determined value. With carrier squelch, all channel activity that exceeds the radio’s preset squelch level can be heard.SRAM See static RAM.SSI See Synchronous Serial Interface.Standby mode An operating mode in which the radio is muted but still continues to monitor data.static RAM A type of memory used for volatile, program/data memory that does not need to be refreshed.Synchronous Serial InterfaceDSP interface to peripherals that consists of a clock signal line, a frame synchronization signal line, and a data line.system central controllersMain control unit of the trunked dispatch system; handles ISW and OSW messages to and from subscriber units (See ISW and OSW).system select The act of selecting the desired operating system with the system-select switch (also, the name given to this switch).thin small-outline packageA type of dynamic random-access memory (DRAM) package that is commonly used in memory applications.time-out timer A timer that limits the length of a transmission.TOT See time-out timer.transceiver Transmitter-receiver. A device that both transmits and receives analog or digital signals. Also abbreviated as XCVR.transmitter Electronic equipment that generates and amplifies an RF carrier signal, modulates the signal, and then radiates it into space.TSOP See thin small-outline package.Term Definition

March 23, 2006 6816812H01Glossary-8TX Transmit.UART See also Universal Asynchronous Receiver Transmitter.UHF Ultra-High Frequency.Universal Asynchronous Receiver TransmitterA microchip with programming that controls a computer's interface to its attached serial devices.Universal Serial Bus An external bus standard that supports data transfer rates of 12 Mbps.USB See Universal Serial Bus.VCO See voltage-controlled oscillator.VHF Very-High Frequency.VIP Vehicle Interface Port.VOCON See vocoder/controller.vocoder An electronic device for synthesizing speech by implementing a compression algorithm particular to voice. See also voice encoder.vocoder/controller A PC board that contains an ASTRO radio’s microcontroller, DSP, memory, audio and power functions, and interface support circuitry.voice encoder The DSP-based system for digitally processing analog signals, and includes the capabilities of performing voice compression algorithms or voice encoding. See also vocoder.voltage-controlled oscillatorAn oscillator in which the frequency of oscillation can be varied by changing a control voltage.Term Definition

Index IndexNumerics100W radiosconfigurations ........................................................1-2Aaccessoriesconnector assembly ...............................................3-1installingdash mount ........................................................3-1emergency pushbutton .......................................3-1footswitch ...........................................................3-1horn relay ...........................................................3-1light relay ............................................................3-1remote mount .....................................................3-1antennacable, see Cables, antennaconnection .............................................................2-9diagrams .......................................................2-9, 2-10installing .................................................................2-8mounting ................................................................2-8site .........................................................................2-8Bbase stations .............................................................1-2black lead ..................................................................2-6Ccablesaccessory ....................................... 2-12, 3-1, 3-2, 3-3antenna ...........................................................2-4, 2-9diagrams ................................................. 2-2, 2-7, 2-9ignition ...................................................................2-8ignition sense .........................................................2-8power .....................................................................2-6programming ......................................................... A-5tools .......................................................................1-3configurations100W radios ...........................................................1-2dash mount ............................................................1-2control headdash mount ............................................................1-2see also specific model namescontrol stations ..........................................................1-2Ddash mountaccessories installations ........................................3-1configuration ..........................................................1-2installation ..............................................................2-2installation examples .............................................2-1radio dimensions ...................................................1-1trunnion .................................................................2-5Eemergency footswitch ........................................3-1, 3-2emergency pushbutton ......................................3-1, 3-2external alarmsee also Horn relay or Light relayFfootswitch, emergency .......................................3-1, 3-2Ggreen lead .................................................................2-8Hhorn relay ...........................................................3-1, 3-3Iignitioncable ......................................................................2-8installationexamples ...............................................................2-1JJ2pin configuration ....................................................2-2Lleadsblack ......................................................................2-6green .....................................................................2-8orange ...................................................................2-8light relay ............................................................3-1, 3-3locking kit, installing ..................................................2-6Mmicrophonehang-up box ........................................................2-12hang-up clip, standard .........................................2-12S-hook ..........................................................2-5, 2-12mounting configurations ............................................2-4dash ................................................................1-2, 2-5mounting, antennarestrictions .............................................................2-9roof top ..................................................................2-8trunk lid ..................................................................2-8

Index-2March 23, 2006 6816812H01Oorange lead ............................................................... 2-8ordering replacement parts .......................................A-1Pparts, ordering replacement ......................................A-1pinfunctions ................................................................ 3-4ground ................................................................... 3-1removal tool ........................................................... 1-3SW B+ ................................................................... 3-1VIP out .................................................................. 3-1pin configurationsJ2 .......................................................................... 2-2pushbutton, emergency .....................................3-1, 3-2Rrear accessory jack, see J2relayshorn ................................................................3-1, 3-3light .................................................................3-1, 3-3remote mountaccessory installations .......................................... 3-1installation examples ............................................. 2-1replacement parts, ordering ......................................A-1Sspeakerconnecting ........................................................... 2-12mounting .................................................... 2-10, 2-11Ttools, required ........................................................... 1-3trunnionbelow dash mounting ............................................ 2-5bracket for speaker ............................................. 2-10dash mount ........................................................... 2-5locking kit .............................................................. 2-6mounting bracket .................................................. 2-5orientation ............................................................. 2-4transmission hump mounting ................................ 2-5VVIPconnector .............................................................. 3-1WW4 control head ....................................................... 3-1W5 control head ....................................................... 3-1W7 control head ....................................................... 3-1W9 control head ....................................................... 3-1wiring diagrams ........................................................ 2-2