Horizon Hobby XP662 JR XP662 6 Channel FM Radio System User Manual XP662 Manual

Horizon Hobby, LLC JR XP662 6 Channel FM Radio System XP662 Manual

XP662 Manual

6-CHANNEL COMPUTER RADIOINSTRUCTION MANUALFOR AIRPLANE ANDHELICOPTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 1
3984 JR XP662 Manual 1/21/02 1:11 PM Page 2
3XP662 MANUAL Table of ContentsTABLE OF CONTENTS I. INTRODUCTIONIntroduction to the XP662 Radio System 4Quick Start (Airplane) 5Quick Start (Helicopter) 71. Using This Manual 92. Features 92.1 Transmitter Features 92.2 Receiver Features 92.3 Servo Features 102.4 Servo Layout 103. Specifications 113.1 System Specifications 113.2 Transmitter Specifications 113.3 Servo Specifications 113.4 Receiver Specifications 123.5 Charger Specifications 123.6 Airborne Battery Pack 124. Battery Charging 134.1 Transmitter/Receiver 134.2 Charger 135. Trainer System 14II. AIRPLANE SECTION1. Transmitter Controls 151.1 Control Identification and Location 151.2 Digital Trim Levers 151.3 Receiver Channel Assignment/Transmitter Throttle ATL161.4 Transmitter Rear 161.5 Control Stick Length Adjustment 171.6 Direct Servo Control (DSC) 171.7 Neck Strap Attachment 172. Connections 182.1 Installation Requirements 182.2 Connections 183. Key Input and Display 194. Battery Alarm and Display 195. Input Mode and Function 205.1 Normal Display 205.2 Direct Trim Access Display 205.3 System Mode 205.4 Function Mode 215.5 Throttle Cut 216. Functions (System Mode) 226.1 Model Type Selection 226.2 Data Reset 236.3 Dual Rate Switch Selection 246.4 Wing Type Selection 256.5 Model Selection 276.6 Model Name Entry 286.7 Modulation Select 296.8 Fail-Safe/Hold 306.9 Fail-Safe/Hold Function in Z-PCM Modulation 306.10 Fail-Safe/Hold Function in S-PCM Modulation 327. Functions (Function Mode) 347.1 Servo Reversing 347.2 Dual Rate 357.3 Exponential 367.4 Sub-Trim 377.5 Travel Adjustment 387.6 Aileron-to-Rudder Mixing 397.7 Elevator-to-Flap Mixing 417.8 Differential 437.9 Flap-to-Elevator Offset Trim 447.10 Programmable Mixing (A, B, C) 458. Data Sheet 48III. HELICOPTER SECTION1. Transmitter Controls 491.1 Control Identification and Location 491.2 Receiver Channel Assignment/Transmitter Throttle ATL 491.3 Transmitter Rear 501.4 Control Stick Length Adjustment 511.5 Direct Servo Control (DSC) 511.6 Neck Strap Attachment 512. Connections 522.1 Installation Requirements 522.2 Connections 523. Key Input and Display 534. Battery Alarm and Display 535. Input Mode and Function 545.1 Normal Display 545.2 System Mode 545.3 Function Mode 556. Functions (System Mode) 566.1 Model Type Selection 566.2 Data Reset 576.3 Dual Rate Switch Selection 586.4 Gear/Gyro Switch Selection 596.5 Model Selection 606.6 Model Name Entry 616.7 Modulation Select 626.8 Fail-Safe/Hold 636.9 Fail-Safe/Hold Function in Z-PCM Modulation 636.10 Fail-Safe/Hold Function in S-PCM Modulation 657. Functions (Function Mode) 677.1 Servo Reversing 677.2 Dual Rate 687.3 Exponential 697.4 Sub-Trim 707.5 Travel Adjustment 717.6 Throttle Hold 727.7 Pitch Curve 737.8 Throttle Curve 747.9 Revolution Mixing 757.10 Programmable Mixing (A) 767.11 CCPM Swashplate mixing 797.12 CCPM Servo Connections 807.13 How 120 CCPM works 818. Data Sheet 83IV. IMPORTANT INFORMATION1. General Notes 932. Daily Flight Checks 933. Warranty Coverage 944. Repair Service Instructions 945. Frequency Chart 953984 JR XP662 Manual 1/21/02 1:11 PM Page 3
4XP662 MANUAL IntroductionIncluded with the XP662 Radio System is aswitch/function decal sheet. These decals have beenprovided as a guide to specific switch positions,functions, and abbreviations used when operating theXP662.The four small decals help identify switch positions anduse for helicopter and aircraft modes.The large decal at the bottom of the sheet givesabbreviations and definitions for all of the aircraft andhelicopter functions. The functions decal will prove to bea helpful guide for making program changes to yourXP662 both in the shop and at the flying field.We strongly encourage all prospective and current R/Caircraft pilots join the Academy of Model Aeronautics. TheAMA is a non-profit organization which provides servicesto model aircraft pilots. As an AMA member you willreceive a monthly magazine entitled Model Aviation, aswell as a liability insurance plan to cover against possibleaccident or injury. All AMA charter aircraft clubs requireindividuals to hold a current AMA sporting license prior tooperation of their models. For further information you cancontact the AMA at:Academy of Model Aeronautics5151 East Memorial DriveMuncie, IN 47302(317) 287-1256Thank you for purchasing the JR XP662 6-Channel RadioSystem. This unit has been designed to provide themodeler with a high quality, user friendly radio systemthat can be depended upon for years to come. It is important that you carefully read this manual beforeattempting to operate your XP662 System. Please payparticular attention to Page 13, Chapter 4 Charging YourXP662 Radio System, prior to Installing.XP662 SWITCH FUNCTION DECAL SHEETAMA INFORMATIONFLAPUPDOWNOFFONMIX ORGEARDOWNUPOFFONMIXORTHROTTLE HOLDNORMALHOLDFLIGHT MODENORMALSTUNT72MHzFM TXREV – Servo ReversingAIRPLANED/R – Dual RatesSB-TRIM – Sub-TrimTRV ADJ – Travel AdjustmentMIX A-R – Ailer./Rudder MixingMIX E-F – Elevator/Flap MixingOFFSET – Landing Elev. OffsetREV – Servo ReversingD/R – Dual RatesSB-TRIM – Sub-TrimHLD – Throttle HoldHELICOPTERTRV ADJ – Travel AdjustmentPLNP2NPHNPLSP2SPHSPLHP2HPHHTLNT2NTHNTLST2SMIXRVURVDOFFSET – Rudder Offset– Pitch Low Normal– Pitch Med. Normal– Pitch High Normal– Pitch Low Stunt– Pitch Med. Stunt– Pitch High Stunt– Pitch Low Hold– Pitch Med. Hold– Pitch High Hold– Throttle Low Norm.– Throttle Med. Norm.– Throttle High Norm.– Throttle Low Stunt– Throttle Med. Stunt– Revo Mixing– Revo Mixing Up– Revo Mixing DownDECAL SHEETHELICOPTERDECAL POSIITONTop View (Mode II)AIRPLANEDECAL POSITIONTop View (Mode II)REAR DECAL POSITIONAirplane and HelicopterINTRODUCTION TO THE XP662 RADIO SYSTEM • IntroductionXP662 FUNCTION GUIDETX BACKHELITOPLEFT NORMALSTUNTFLIGHT MODENORMALSTUNTTHROTTLE HOLDAIRTOPLEFTHELITOPRIGHTAIRTOPRIGHTMIX OR FLAPDOWN OFFUP ONOFF DOWNON UPGEAR OR MIXAirplaneREV Servo ReversingD/R Dual RatesEXP ExponentialSB-TRIM Sub-TrimTRV ADJ Travel AdjustmentMIX A-R Aileron/Rudder MixMIX E-F Elevator/Flap MixingMIX DIF DifferentialOFFSET Flap/Elevator OffsetMIX A Programmable Mix AMIX B Programmable Mix BMIX C Programmable Mix CHelicopterREV Servo ReversingD/R Dual RatesEXP ExponentialSB-TRIM Sub-TrimTRV ADJ Travel AdjustmentHLD Throttle HoldPLN Pitch Low NormalP2N Pitch Med. NormalPHN Pitch High NormalPLS Pitch Low StuntP2S Pitch Med. StuntPHS Pitch High StuntPLH Pitch Low HoldP2H Pitch Med. HoldPHH Pitch High HoldTLN Throttle Low Norm.T2N Throttle Med. Norm.THN Throttle High Norm.TLS Throttle Low StuntT2S Throttle Med. StuntMIX Revo MixingRVU Revo Mixing UpRVD Revo Mixing DownMIX A Programmable Mix ACCP CCPM Swashplate MixXP6 62 FUNCTION GUIDETx BACKHELITOPLEFT NORMALSTUNTFLIGHT MODENORMALSTUNTTHROTTLE HOLDAIRTOPLEFTHELITOPRIGHTAIRTOPRIGHTMIX OR FLAPDOWN OFFUP ONOFF DOWNON UPGEAR OR MIXAirplaneREV Servo ReversingD/R Dual RatesEXP ExponentialSB-TRIM Sub-TrimTRV ADJ Travel AdjustmentMIX A-R Aileron/Rudder MixMIX E-F Elevator/Flap MixingMIX DIF DifferentialOFFSET Flap/Elevator OffsetMIX A Programmable Mix AMIX B Programmable Mix BMIX C Programmable Mix COFFSET Trim Offset MemoryHelicopterREV Servo ReversingD/R Dual RatesEXP ExponentialSB-TRIM Sub-TrimTRV ADJ Travel AdjustmentHLD Throttle HoldPLN Pitch Low NormalP2N Pitch Med. NormalPHN Pitch High NormalPLS Pitch Low StuntP2S Pitch Med. StuntPHS Pitch High StuntPLH Pitch Low HoldP2H Pitch Med. HoldPHH Pitch High HoldTLN Throttle Low Norm.T2N Throttle Med. Norm.THN Throttle High Norm.TLS Throttle Low StuntT2S Throttle Med. StuntMIX Revo MixingRVU Revo Mixing UpRVD Revo Mixing DownMIX A Programmable Mix ASTT Stunt TrimCCP CCPM Swashplate MixOffset Trim Offset Memory3984 JR XP662 Manual 1/21/02 1:11 PM Page 4
5XP662 MANUAL IntroductionQUICK STARTAIRPLANEModel Type SelectionServo ReversingREV◆NORMTHRCHANNELSCROLL INCREASEDECREASEENTERACTYPACTYP9.7VACIACTYPIn this manual you will find in-depth instructions thatdetail all the steps and procedures you should follow inorder to program each of the XF662’s features. Formodelers who want to get into the air fast, we haveprovided Quick Start. Quick Start covers the basicprogramming information necessary to get you airborne.Later, when you want to learn more about specificfeatures of the XP662, turn to the appropriate page(s) inthis manual for more detailed programming information.If AC appears on the screen procede directly toStep 4. If HE appears press the INCREASE orDECREASE button until “AC” appears, thenpress the SCROLL and INCREASE buttonssimultaneously to store the model type change.Press the SCROLL and INCREASEbuttons simultaneously and holdwhile turning on the transmitter.Press the SCROLL button until“TYP” appears on the screen.Turn the transmitter off and then on again.Digital Trim Settings Check to ensure that the aileron, elevator, andrudder trim values are set to the 0 (neutral) position.Next, set the throttle value to the full low (-40)position by pressing the throttle trim lever down.1 23 456With the transmitter on, press theSCROLL and INCREASE buttonsupward simultaneously until abeep is heard.REV◆NORMTHRCHANNELSCROLL INCREASEDECREASEENTER7Press the SCROLL button (if necessary)until “REV-NORM” appears on the screen.REV◆NORMTHRCHANNELSCROLL INCREASEDECREASEENTER8Press theCHANNELbutton to selectthe channel youwant to reverse.Press the INCREASE orDECREASE button toreverse the direction of the channel you selected.3984 JR XP662 Manual 1/21/02 1:11 PM Page 5
6XP662 MANUAL IntroductionAIRPLANETravel AdjustmentCHANNELSCROLL INCREASEDECREASEENTERTRV ADJ. AIL+I00%9Press the SCROLLbutton until “TRV ADJ” appearson the screen.Press the CHANNELbutton to select thechannel on which youwant the travel adjusted.CHANNELSCROLL INCREASEDECREASEENTERTRV ADJ. AIL+I00%10INCREASETo increase the travel,move the stick (i.e. aileron)to the right then press theINCREASE button toadjust the right travel.Release the INCREASEbutton and move the samestick to the left. Press theINCREASE button toadjust the left travel.DECREASETo decrease the travel,move the stick (i.e. aileron)to the right then press theDECREASE button toadjust the right travel.Release the DECREASEbutton and move the samestick to the left. Press theDECREASE button toadjust the left travel.CHANNELSCROLL INCREASEDECREASEENTERTRV ADJ. AIL+I00%11Press the SCROLL and INCREASE buttonsupwards simultaneously to return to the mainscreen and exit the Function mode.Throttle Auto CutBefore the initial start of your model, please check toensure that when the THROTTLE CUT button is pressed,the engine’s carburetor barrel will move to the fully closed(engine off) position.This safety feature ensures that the engine can be shut offimmediately in case of a problem or safety concern.Please note that the throttle cut button is only active whenthe throttle stick is below 1/2 throttle, and a trim value hasbeen added to the throttle trim lever.12QUICK STARTTHROTTLE CUT BUTTON3984 JR XP662 Manual 1/21/02 1:11 PM Page 6
7XP662 MANUAL IntroductionHELICOPTER QUICK STARTModel Type SelectionServo ReversingREV◆NORMTHRCHANNELSCROLL INCREASEDECREASEENTERACTYPACTYP9.7VACIACTYPIf “HE”appears on the screen, procede directlyto Step 4. If “AC”appears, press the INCREASEor DECREASE button until “HE”appears, thenpress the SCROLL and INCREASE buttonssimultaneously to store the model type change.Press the SCROLL and INCREASEbuttons simultaneously and holdwhile turning on the transmitter.Press the SCROLL button until“TYP”appears on the screen.Turn the transmitter off and then on again.Digital Trim Settings Check to ensure that the aileron, elevator, andrudder trim values are set to the 0 (neutral)position. Next, set the throttle value to the full low (-40) position by pressing the throttle trim lever down.1 23 456With the transmitter on, press theSCROLL and INCREASE buttonsupward simultaneously until abeep is heard.REV◆NORMTHRCHANNELSCROLL INCREASEDECREASEENTER7Press the SCROLL button (if necessary)until “REV-NORM”appears on the screen.REV◆NORMTHRCHANNELSCROLL INCREASEDECREASEENTER8Press theCHANNELbutton to selectthe channel youwant to reverse.Press theINCREASE orDECREASEbutton to reversethe direction ofthe channel youselected.3984 JR XP662 Manual 1/21/02 1:11 PM Page 7
8XP662 MANUAL IntroductionHELICOPTERPitch CurvePress theSCROLLbutton until“PLN”appearson the screen.0%Press theCHANNEL buttonto select stickposition (pointlocation).Press the INCREASEor DECREASE buttonto adjust the pointvalue at the selectedstick position.0%STICK POSITION (POINT LOCATION)L=Low2 = CenterH = HighPRESET VALUESL= 0%2 = 50%H = 100%RECOMMENDED INITIALPITCH SETTINGS(Please refer to your helicopter kitinstruction for pitch settings if available)L = 0°Pitch2 = 5°PitchH = 9°PitchQUICK STARTTravel AdjustmentCHANNELSCROLL INCREASEDECREASEENTERTRV ADJ. AIL+I00%9Press the SCROLLbutton until “TRV ADJ”appearson the screen.Press the CHANNELbutton to select thechannel on which youwant the travel adjusted.CHANNELSCROLL INCREASEDECREASEENTERTRV ADJ. AIL+I00%10INCREASETo increase the travel,move the stick (i.e. aileron)to the right then press theINCREASE button toadjust the right travel.Release the INCREASEbutton and move the samestick to the left. Press theINCREASE button toadjust the left travel.DECREASETo decrease the travel,move the stick (i.e. aileron)to the right then press theDECREASE button toadjust the right travel.Release the DECREASEbutton and move the samestick to the left. Press theDECREASE button toadjust the left travel.Throttle Auto CutBefore the initial start of your model, pleasecheck to ensure that when the THROTTLECUT button is pressed, the engine’scarburetor barrel will move to the fullyclosed (engine off) position.This safety feature ensures that the enginecan be shut off immediately in case of aproblem or safety concern.Please note that the THROTTLE CUT button is only activewhen the throttle stick is below 1/2 throttle, and a trim valuehas been added to the throttle trim lever.1311 12THROTTLE CUT BUTTONCHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 8
9XP662 MANUAL IntroductionThe XP662 is a full feature introductory computerradio for airplanes and/or helicopters. This manual isdivided into two main sections: airplanes andhelicopters. You need only refer to the section thatpertains to the type of model you are programming—e.g., if you are programming your XF662 for helicopters,follow the instructions in the helicopter section. Blank data sheets are included at the end of bothsections. Once you have input all the necessary datainto your transmitter for a particular model, westrongly recommend that you immediately write that information down on a copy of the data sheetprovided. This is to insure that, in the rare case of a memory failure, you will not lose your data.Airplane and Helicopter Mode•Easy-to-read LCD screen• 6-model name entry•6-model memory•Dual rates on aileron and elevator•Dual rates can be combined on one switch•Exponential rate on aileron and elevator•Trainer system compatible with most JR radios•Easy-access programming buttons•Computer designed ergonomically styled case•Adjustable stick length•Throttle trim only affects idle position•Two speed scrolling: press and hold theappropriate button to scroll quickly or press andrelease to scroll in steps•FM/PCM selectable•Fail-safe/fail-safe memory (PCM only)•Digital trims for precise adjustmentAirplane Mode•Aileron to rudder mixing•Elevator to flap mixing•Flap to elevator mixing•Flaperons mixing•Delta wing mixing•Aileron differential•V-tail mixing•Three programmable mixes •Mixing differentialHelicopter Mode•Two 3-point throttle curves•Two 3-point pitch curves (three when throttlehold is activated)•Flight mode switch can combine throttle curve,pitch curve, dual rates, and gyro sensitivity•Throttle hold•Revolution mixing up and down•Programmable mixing•Optional 120° CCPM Swashplate mixing•Separate trim setting for all flight modesR700 Slimline Receiver•The R700’s extremely compact “slimline” designallows it to fit easily in limited spaces.•An independent laboratory ranked the R700 Receiver with JR’s patented ABC&W circuitry as one of the best receivers ever tested in terms of 3IM, 2IM, signal-to-noise ratio, adjacent channel rejection, and on-channel capture point.•The R700 is compatible with all JR FMtransmitting radios.•A special “unwanted interference limiter” ignoressignals outside of the R700’s band width when the receiver is on and the transmitter is off. The limiter also prevents servos from random glitching when other transmitters are operating in close proximity.•The electrical circuitry is state-of-the-art surface mount technology (SMT). These SMT componentsdraw less current, thus increasing flying time. Flush mounting of these components also reduces the risk of vibration, wear, and damage.CHAPTER 1:USING THIS MANUAL • IntroductionUSING THIS MANUAL1CHAPTER 2:FEATURESTRANSMITTER FEATURES2.1RECEIVER FEATURES2.23984 JR XP662 Manual 1/21/02 1:11 PM Page 9
10 XP662 MANUAL IntroductionCHAPTER 2:FEATURES • Introduction 537 Servo•An ultra-tight deadband amplifier ensuresaccurate neutral centering•Low-current drain•Ball bearing supported ouput shaft with newwide spacing for improved precision•An indirect drive feedback potentiometer gives additional protection from vibrationSERVO FEATURES2.3SERVO LAYOUT2.4Servo Mounting FlangeRubber GrommetsRubber GrommetsServo CaseServo Lead w/ConnectorServo Output ShaftServo Mounting FlangeServo Arm/HornServo Arm Retaining ScrewServo EyeletTop View3984 JR XP662 Manual 1/21/02 1:11 PM Page 10
11XP662 MANUAL IntroductionCHAPTER 3:SPECIFICATIONS • IntroductionSYSTEM SPECIFICATIONSTRANSMITTER SPECIFICATIONS3.13.2SYSTEM NAME XP662A XP662HTRANSMITTER BODY NET-XP662A NET-XP662HRECEIVER R700 R700CHARGER NEC-221 NEC-222AIRBORNE BATTERY 4N-600 4N-1000SERVOS NES-537BBX4 NES-537BBX5ACCESSORIES Mini Switch Mini Switch12" Aileron Extension 12" Aileron ExtensionServo Accessories Servo AccessoriesInstruction Manual Instruction ManualFunction Guide Function GuideTYPE AIRPLANE HELICOPTERMODEL NUMBER NET-XP662A NET-XP662HENCODER 6-Channel Computer System 6-Channel Computer SystemRF 50/72MHz 50/72MHzMODURATION PPm (FM), PCM (S,Z) PPm (FM), PCM (S,Z)OUTPUT POWER Approximately 1 Watt Approximately 1 WattCURRENT DRAIN 200mA 200mAPOWER SOURCE 1.2Vx8 Ni-Cd (9.6V) 600mAh 1.2Vx8 Ni-Cd (9.6V) 600mAhOUTPUT PULSE 1000-2000 (1500 Neutral) 1000-2000 (1500 Neutral)TYPE AIRPLANE HELICOPTERSERVO SPECIFICATIONS3.3TORQUE (oz/in) 43 ozSPEED .25WEIGHT 1.37SIZE (in) (W x L x H) 0.73 x 1.52 x 1.32BB YESMOTOR 3-Pole FeriteTYPE 537BB3984 JR XP662 Manual 1/21/02 1:11 PM Page 11
12 XP662 MANUAL IntroductionRECEIVER SPECIFICATIONS3.4CHARGER SPECIFICATIONSAIRBORNE BATTERY PACK3.53.6MODEL NUMBER NER-700TYPE 7-Channel/FM Slimline ABC & W CircuitryFREUENCY 50/72MHzSENSITIVITY (Microseconds) 5µs MinimumSELECTIVITY 8KHz/50dBWEIGHT(oz) 0.64 ozSIZE(in) (W x L x H) 1.84 x 0.98 x 0.16RECEIVER ANTENNA 39" For All Aircraft FrequenciesTYPE R700 FMMODEL NUMBERINPUT VOLTAGEOUTPUT CURRENTCHARGING TIMENEC-211AC 100-120V50mAh TX/50mAh RX15 HoursNEC-222AC 100-120V50mAh TX/150mAhRX15 HoursTYPE AIRPLANE HELICOPTERMODEL NUMBERVOLTAGESIZE (in) (W x L x H)WEIGHT (oz)4n-6004.8V2.24 x 0.59 x 2.053.34N-10004.8V2.60 x 0.63 x 1.704.9TYPE AIRPLANE HELICOPTERCHAPTER 3:SPECIFICATIONS • Introduction3984 JR XP662 Manual 1/21/02 1:11 PM Page 12
13XP662 MANUAL IntroductionCHAPTER 4:BATTERY CHARGING • IntroductionThe pilot lamps should always be on during thecharging operation. If they are not, check to makesure you have turned off both the transmitter and receiver.Do not use the charger for equipment other than JR.The charging plug polarity may not be the same andequipment damage may result.Do not use other manufacturers’ after-marketaccessories that plug into the transmitter’s chargingjack. If you do, any damage that results will not becovered by warranty. If you are unsure ofcompatibilities with your radio, seek expert advicebefore doing anything to avoid possible damage.During the charging operation, the charger’stemperature is slightly elevated. This is normal.CHARGER4.2It is imperative that you fully charge both thetransmitter and the receiver battery packs prior toeach day of flying. For the initial charge, leave thecharger and batteries hooked up for 20–24 hours inorder to fully charge both battery packs to peakcapacity. For subsequent charges, leave the chargerand batteries hooked up overnight (approximately 16 hours). The charger supplied with this system is designed torecharge your transmitter battery at a rate of 50mA.The receiver battery pack will charge at 50mA for the600mAh airplane battery pack and at 150mA for the1000mAh helicopter battery pack.Transmitter OnlyThe center pin on all JR remote control systems is negative. Therefore, the center pin on all JR chargers is negative, not positive. This is different from any other manufacturers’ chargers and radio systems. Beware of improper connections based on “color code” wire leads, as they do not apply in this instance. You must make certain that the center pin of your JR transmitter is always connectedto the negative voltage for correct polarity hookup.CENTER PIN IS NEGATIVEOUTSIDE IS POSITIVERIGHT SIDE OF TRANSMITTERCHARGER PIGTAIL FOR RECEIVERCHARGER PIGTAIL FOR TRANSMITTERBLACK TO POSITIVERED TO NEGATIVERED–POSITIVE / BROWN–NEGATIVE / ORANGE–SIGNALTRANSMITTER/RECEIVER4.13984 JR XP662 Manual 1/21/02 1:11 PM Page 13
14 XP662 MANUAL IntroductionThe XP662 features a built-in trainer system. Thetransmitter can be used as either a master (trainer) oras a slave (trainee). The XP662 is compatible with allother current JR radios that have built-in trainersystems. An optional Trainer Cord (JRPA130) is needed .1. Match the servo reversing and trims of both radios.2. Plug the optional trainer cord into both transmitters.3. Turn on the master transmitter. (Note: The slave radio must be left off.)4. Test all the control functions on your aircraft withthe master radio.5. Push the trainer button on the mastertransmitter and check all the control functionswith the slave radio.CHAPTER 5:TRAINER SYSTEM • IntroductionTRAINER SYSTEM5D.S.C. TRAINER CORD INPUTONTRAINERELEVATOR D/R 0101AILERON D/RSCROLLCHANNELINCREASEDECREASE622FUNCTION 3-4 1-4 FUNCTION 1-2 2-3MULTIDATADISPLAYVOLTAGEINDICATORONTRAINERELEVATOR D/RFLIGHT MODEGEAR/MIX 01THROTTLE HOLDFLAP/MIX 01AILERON D/RSCROLLCHANNELINCREASEDECREASE622XP662 FUNCTION 3-4 1-4 FUNCTION 1-2 2-3MULTIDATADISPLAYVOLTAGEINDICATORTRAINER BUTTONOPTIONAL TRAINER CORD(JRPA130)MASTER TXPOWER SWITCH ON SLAVE TXPOWER SWITCH OFFTHROTTLE CUTDIGITAL TRIM EQUIPPED 6 CHANNELMULTI-DATA DISPLAY SYSTEMENTER ENTERXP662DIGITAL TRIM EQUIPPED 6 CHANNELMULTI-DATA DISPLAY SYSTEMTHROTTLE CUTFLIGHT MODEGEAR/MIX THROTTLE HOLDFLAP/MIXOperating the Trainer System3984 JR XP662 Manual 1/21/02 1:11 PM Page 14
AUX 1/FLAP MIXINGAILERON DUAL RATEANTENNALCD SCREENGEAR SWITCHELEVATOR DUAL RATETRAINER BUTTONAILERON/ELEVATOR STICKTHROTTLE/RUDDER STICKPOWER SWITCHAILERON TRIMELEVATOR TRIMTHROTTLE TRIMRUDDER TRIMNECK STRAP EYELETINPUT KEYSCARRYING HANDLETHROTTLE CUT BUTTON15XP662 MANUAL AirplaneThe XP662 features four digital trim levers with adirect trim display feature for ultra preciseadjustments. When a trim input is given, the displayscreen will automatically change to show the trimvalue for current channel being adjusted. Once thetrim change has been completed, the screen willautomatically return to the previous screen displayafter 2–3 seconds.A significant feature found only with Digital Trims isthe ability for the XP662 to automatically store thetrim values in the system memory. This eliminatesthe need for previously found software functions likeTrim Offset Memory, Rudder Offset Memory (Heli),and Stunt Trim (Heli).In Heli mode, the XP662's digital trims provide aseparate set of trim values for each Flight mode(Normal, Stunt, and Throttle Hold), which takes theplace of the previously needed Stunt Trim function.With this feature, the trim levers are active in allflight modes, and will store the trim values for eachmode independantly. This feature also takes theplace of the previously needed rudder offsetfunction, since there is now a completely separateset of trim setting for the Throttle Hold mode.DIGITAL TRIM LEVERS1.2CONTROL IDENTIFICATION AND LOCATION • Mode IICHAPTER 1:TRANSMITTER CONTROLS • Airplane1.13984 JR XP662 Manual 1/21/02 1:11 PM Page 15
16 XP662 MANUAL AirplaneCRYSTALCARRYING HANDLETRAINER JACKBATTERYTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER1.4Note: Your transmitter has a 5-year lithium batteryto protect your pre-programmed data against maintransmitter battery failure. If your system reads 0.0 volts or has an unfamiliar display (service mode)or your data resets to the factory defaults, returnyour transmitter to Horizon Service Center (see page 85) for lithium battery replacement.BATTERY CONNECTORUse caution when disconnecting/removing thetransmitter battery pack as if the connector is notproperly disconnected, damage to the connectorand/or the radio system can result.1. THRO Throttle Channel2. AILE Aileron Channel3. ELEV Elevator Channel4. RUDD Rudder Channel5. GEAR Gear Channel6. AUX 1 Auxiliary 1 Channel (Flap)Transmitter Throttle ALTThe Throttle ALT function makes the throttle sticktrim active only when the throttle stick is less thanhalf throttle. This gives easy, accurate idle adjustmentswithout affecting the high throttle position.RECEIVER CHANNEL ASSIGNMENT/TRANSMITTER THROTTLE ALT1.3(Factory Installed)Transmitter Crystal Replacement NoticeThe Federal Communications Commission (FFC) requires thatchanges in transmitter frequency must be performed only by anauthorized service technician (Horizon Service Center). Anytransmitter frequency change made by non-certified technicianmay result in a violation of the FCC rules.CHAPTER 1:TRANSMITTER CONTROLS • Airplane3984 JR XP662 Manual 1/21/02 1:11 PM Page 16
17XP662 MANUAL AirplaneCHAPTER 1:TRANSMITTER CONTROLS • AirplaneTo adjust the control stick length, use a 2mm Allenwrench to unlock the set screw located inside the endof the control stick. Turn the set screw counterclockwiseto loosen it, then turn the knurled portion of the stickto adjust the length. Counterclockwise will lengthenthe stick and clockwise will shorten it. After thecontrol stick(s) has been adjusted to suit your flyingstyle, tighten the set screw.For proper DSC hook-up and operation:1. Leave the transmitter power switch off. The transmitter will not transmit any radio frequency (RF) in this position.2. Plug the optional DSC Cord (JRPA132) into the DSC port in the rear of the transmitter.3. The encoder section of the transmitter will now be operational and the LCD display will be lit.4. Plug the other end of the DSC Cord into the receiver charge receptacle. Turn on the switch harness.Note: When installing the optional charging jack (JRPA024), be sure to hook the charging jack receptacle securely into the switch harness charge cord.Why you should use the DSC function:1. The DSC enables you to check the control surfaces of your airplane without drawing the fully operational 200mAh from your transmitter battery pack. Instead, you will only draw 70mAh when using the DSC function.Note: You will need to purchase (separately) both the DSC Cord (JRPA132) and the JR Deluxe Switch Harness (JRPA001) to make use of the XP662 DSC function.2. The DSC function allows you to make final adjustments to your airplane or helicopter without transmitting any radio signals. Therefore, if another pilot is flying on your frequency, you can still adjust your aircraft and not interfere with the other aircraft.Note: Under no circumstances should you attempt to fly your aircraft with the DSC Cord plugged in! This feature is for bench checking your aircraft only.There is an eye hook on the front of the transmitterfor attaching an optional neck strap (JRPA023). Theeye hook is precisely positioned (see Section 1.1) so that the transmitter will be perfectly balancedwhen a neck strap is used.CONTROL STICK LENGTH ADJUSTMENT1.5LOOSENTIGHTENSET SCREWDIRECT SERVO CONTROL (DSC)1.6ABCA—Charge Cord/DSC ReceptacleB—Switch Harness LeadC—Charger/DCS CordNECK STRAP ATTACHMENT1.73984 JR XP662 Manual 1/21/02 1:11 PM Page 17
18 XP662 MANUAL AirplanePlease read and carefully follow these suggestions.1. For added protection, wrap the RX and the RX Ni-Cd in foam rubber that is at least 1/4” thick.2. Run the RX antenna through the fuselage and make sure it is fully extended. Never cut or bundle your RX antenna—this will decrease range and performance.3. Rubber servo grommets are included with yourradio system and should be installed in the servoflanges. The servos should then be mounted oneither hardwood rails or a plywood tray with themounting screws provided. Do not overtightenthe mounting screws. The flange of the brasseyelets should face down (toward the wood).4. All servos must be able to move freely over thefull range of their travel. Make sure the linkagesdo not impede servo travel. A stalled servo willdrain the battery pack within a few minutes.5. Before installing servo output arms, make surethe servo is in its neutral position.6. In the case of gas-powered model aircraft, mountthe receiver power switch on the side of the fuselageopposite the muffler to protect the switch fromexhaust residue. With other types of models,mount the switch in the most convenient place.Make sure that the switch operates freely and iscapable of traveling its full distance.7. With your model sitting on the ground and the transmitter antenna collapsed, check that your system works at a distance of 75 to 100 feet.If your system stops functioning at a distancethat is shorter than listed above, please contactthe Horizon Service Center for furtherinformation prior to flying your model.INSTALLATION REQUIREMENTSCHAPTER 2:CONNECTIONS • AirplaneCONNECTIONS2.22.1ONOFFAUXILIARY 1 (FLAP)GEARRUDDERELEVATORAILERONTHROTTLEON/OFF SWITCH HARNESS(JRPA003)RECEIVER BATTERY4N-600226X RECEIVERNEW ABC & W SYSTEM6 CHANNEL RECEIVER BATTAUX 1GEARRUDDELEVAILETHRONER-226XJAPAN REMOTE CONTROL CO., LTDMADE IN JAPAN72MHzANTENNAGEAR7 CH 72MHz FM SLIMLINERECEIVERABC&W INTERFERENCEPROTECTION SYSTEMBATTRUDDELEVAILETHROAUX1R700 RECEIVERANTENNAOptionalOptional3984 JR XP662 Manual 1/21/02 1:11 PM Page 18
19XP662 MANUAL AirplaneCHAPTER 4:BATTERY ALARM AND DISPLAY • AirplaneCHAPTER 3:KEY INPUT AND DISPLAY • AirplaneKEY INPUT AND DISPLAY3When the transmitter battery drops below 9.0 volts,the display will start to flash “BAT” and an audiblealarm will sound for eight beeps. These warningsmean you should land your aircraft immediately. Note: During the period that the battery alarm is flashing, the input buttons will not function. If youare currently in the function mode, the transmitterwill exit automatically and return to the normaldisplay (see Section 5.1).BATTERY ALARM AND DISPLAY4BAT8.9VFLASHINGVTwo input keys are located at the lower right and leftfaceplate of the XP662 transmitter. The keys are usedto access and program the transmitter. Each key canbe moved up or down using your thumbs.CHANNELSCROLL INCREASEDECREASEENTERLeft button up........SCROLL — Used to advancethrough the menusLeft button down...CHANNEL — Used to advance through the channels or featuresin a given functionRight button up........INCREASE — Increases valueor changes setting (e.g., Reverse Normal)Right button down...DECREASE — Decreasesvalue or changes setting(e.g., Reverse Normal)3984 JR XP662 Manual 1/21/02 1:11 PM Page 19
20 XP662 MANUAL AirplaneWhen the power switch is turned on, thescreen will read as shown here in thediagram. This screen is referred to as thenormal display.The Direct Trim function of the XP662 canbe accessed through the use of any of thefour digital trims levers (throttle, aileron,elevator, or rudder). When a trim input is given, the screen willautomatically change to show the trimvalue for that particular channel. Once thetrim adjustment has been made, thescreen will automatically return to theprevious screen setting after 2–3 seconds.The maximum trim value for each channelis +/- 40 in increments of 2.DIRECT TRIM ACCESS DISPLAYCHAPTER 5:INPUT MODE AND FUNCTION • Airplane5.2I0.4VAC I MODEL NUMBERAC = FIXED WING AIRCRAFTHE = HELICOPTERBATTERY VOLTAGENORMAL DISPLAY5.1IMDLIACIIPPMCLFSMACTYPACRSTE.ASWD/ROFWNGMIXMODEL TYPE SELECTION Page 22DATA RESET Page 23DUAL RATE SWITCH SELECTION Page 24Page 25WING TYPESELECTIONFPR FLAPERONMODEL SELECTION Page 27MODEL NAME ENTRY Page 28MODULATION SELECTION Page 29FAIL-SAFE (Z-PCM MODE ONLY) Page 30FAIL-SAFE MEMORY (S-PCM MODE ONLY) Page 32VOFFSITo enter the system mode, press theSCROLL and INCREASE buttonssimultaneously while you turn on thetransmitter. You can now select any of 7 system mode functions shown here inthe flow chart. To exit the system mode,press the SCROLL and INCREASEbuttons simultaneously or turn off thetransmitter. Press the SCROLL button tomove through the system mode functions.Information for each function is locatedon the page number listed next to thefunction name.SYSTEM MODE5.3Only visible when S or Z PCMmodulation is selected3984 JR XP662 Manual 1/21/02 1:11 PM Page 20
Your XP662 incorporates a special THROTTLE CUTbutton located on the upper right face of thetransmitter. This feature is designed to immediatelyoverride any current throttle/trim position and willimmediately return the throttle servo to the full lowposition. This feature will allow the engine to beautomatically stopped in case of emergency, or inthe event of a crash. When adjusting your throttlelinkage, please check to ensure that when theTHROTTLE CUT button is pushed, the throttle servo will move the carburetor barrel to the fullclosed position. Note: In some cases it will be necessary to adjustthe engines barrel stop screw so that thecarburetor can be fully closed. Please refer to yourengine instructions for more detail.The Throttle Cut function is designed to functiononly which the throttle stick is below the 1/2 position,and a trim value has been assigned to the throttletrim levers.THROTTLE CUT5.521XP662 MANUAL AirplaneTo enter the Function mode, turn on the transmitter.Press the MODE and CHANNEL buttonssimultaneously until a beep is heard. The displaywill change accordingly and show the last activefunction. Press the MODE button to scroll downthrough the functions one by one as shown in theflowchart below. Once the appropriate function isselected, use the CHANNEL button to select theappropriate channel. Use the INCREASE andDECREASE buttons to adjust the values displayedon the screen.CHAPTER 5:INPUT MODE AND FUNCTION • AirplaneFUNCTION MODE5.4THR-REV•NORM SERVO REVERSING Page 34DUAL RATE Page 35EXPONENTIAL Page 36SUB-TRIM Page 37TRAVEL ADJUSTMENT Page 38AILERON-TO- RUDDER MIXING Page 39ELEVATOR-TO-FLAP MIXING Page 41DIFFERENTIAL Page 43(will only appear if flaperons orDelta wing types have beenactivated)FLAP-TO-ELEVATOR OFFSET TRIM Page 44PROGRAMMABLE MIXING A Page 45PROGRAMMABLE MIXING B Page 45PROGRAMMABLE MIXING C Page 45I00%AIOD/R0%AIOEXP+I00%TRV ADJA--RMIX00%E--FMIX0%DIFMIX0%F-EOFFSET 0AIIMIX0%BIIMIX0%CIIMIX0%SB-TRIM3984 JR XP662 Manual 1/21/02 1:11 PM Page 21
22 XP662 MANUAL AirplaneTwo types of aircraft programming are available withthe XP662, airplane (AC) and helicopter (HE). Whenyou enter the model type selection function, thecurrent model type will appear on the screen. (Thecurrent model type being the factory preset or thelast model used.) When you press the INCREASE orDECREASE button to change the model type, thenew model type indicated on the screen will flash.For example, if the current model type is AC and youchange to HE, “HE” will flash on the screen. Theflashing alerts you to the change of model type andwill stop once you move to the next function or exitthe system mode.1. Press the SCROLL and INCREASE buttons simultaneously and hold.2. Turn on the transmitter to enter the system mode.3. Press the SCROLL button until “TYP” appears on the screen.4. Press the INCREASE or DECREASE button untilthe desired model type appears on the screen (AC = airplane HE = helicopter).5. Press the SCROLL button to access the Data Reset function.6. To exit, press the SCROLL and INCREASE buttons simultaneously.Accessing the Model Type Selection FunctionMODEL TYPE SELECTIONCHAPTER 6:FUNCTIONS (SYSTEM MODE) • Airplane6.1ACTYP INDICATES MODEL TYPESELECTION FUNCTIONMODEL TYPEAC = AIRPLANEHE = HELICOPTERCHANNELSCROLL INCREASEDECREASEENTERPress the SCROLL buttonuntil “TYP”appears onthe screen.Press the INCREASE or DECREASE buttonuntil the desired model type (AC or HE)appears on the screen.3984 JR XP662 Manual 1/21/02 1:11 PM Page 22
23XP662 MANUAL AirplaneAccessing the Data Reset FunctionCHAPTER 6:FUNCTIONS (SYSTEM MODE) • AirplaneThe data reset function allows you to reset all theprogramming in the selected model (1–6) to thefactory settings. Before using the Data Resetfunction, it’s important to enter the model selectionfunction and select the desired model number (1–6)for which you want to reprogram to the factorysettings. The model selection function is describedin Section 6.2.1. Press the SCROLL and INCREASE buttons up simultaneously and hold.2. Turn on the transmitter to enter the System mode.3. Press the SCROLL button up until “RST” appears on the screen. 4. Press the CHANNEL and INCREASE buttonssimultaneously to reset the data. (To confirmthat the selected model's programming has beenreset, a beep will sound and the model numberwill momentarily disappear from the screen.)5. Press the SCROLL button to access the Model Select function.6. To exit, press the SCROLL and INCREASEbuttons up simultaneously.DATA RESET6.2RSTICHANNELSCROLL INCREASEDECREASEENTERIn System Setup mode,press the SCROLL buttonup until “RST”appears on the screen.Press the CHANNEL button downand INCREASE button upsimultaneously to reset the data(a beep will sound).RST1INDICATES DATA RESET FUNCTIONMODEL NUMBER TO RESET3984 JR XP662 Manual 1/21/02 1:11 PM Page 23
24 XP662 MANUAL AirplaneCHAPTER 6:FUNCTIONS (SYSTEM MODE) • AirplaneThe dual rate switch position is selectable and theelevator and aileron dual rates can be combined onone switch. This allows a single switch to be usedwhen moving from high rates for wild maneuvers tolow rates for mild maneuvers. Exponential Rate(EXP) is also available for both aileron and elevatorand works in conjunction with the dual rate functionto provide mild control movements around neutralwhile allowing maximum servo travel. This reducessensitivity in the middle portion of the stick controland still allows full travel at the end of the stick control.Refer to section 7.3 for exponential rate adjustment.1. Press the SCROLL and INCREASE buttons simultaneously and hold.2. Turn on the transmitter to enter the system mode. 3. Press the SCROLL button until “D/R SW” appearson the screen.4. Press the INCREASE or DECREASE button untilthe desired switch position appears on the screen.5. Press the SCROLL button to access the Wing Type selection function.6. To exit, press the SCROLL and INCREASE buttons simultaneously.Accessing the Dual Rate Switch Selection FunctionDUAL RATE SWITCH SELECTION6.3E.ASW INDICATES DUAL RATE SWITCH FUNCTIONINDICATES SWITCH POSITIONE.A = ELEVATOR AND AILERON OPERATE INDIVIDUALLYA. = OPERATION OF ELEVATOR AND AILERON DUAL RATE ON AILERON DUAL RATE SWITCHE. = OPERATION OF ELEVATOR AND AILERON DUAL RATE ON ELEVATOR DUAL RATE SWITCHCF = OPERATION OF ELEVATOR AND AILERON DUAL RATE ON FLIGHT MODE SWITCHD/RCOMBINED FUNCTION OPERATION OF ELEVATORAND AILERON DUAL RATE ON GEAR/MIX SWITCHCHANNELSCROLL INCREASEDECREASEENTERPress the SCROLLbutton until “D/R SW”appears on the screen.Press the INCREASE or DECREASE buttonuntil the desired switch position appears onthe screen.3984 JR XP662 Manual 1/21/02 1:11 PM Page 24
25XP662 MANUAL AirplaneAccessing the Wing Type Selection FunctionFlaperon, V-tail, and Delta Mixing are available forspecialty aircraft that require those functions. Theflaperon feature mixes flaps with ailerons so theailerons can be drooped for takeoffs and landingswhile still functioning fully as ailerons. V-Tail Mixingcombines rudder and elevator for V-Tail operations.The Delta Wing function allows the aileron to alsoact as the elevator, while retaining independent useof both functions. The Delta Wing function allows theailerons to also act as the elevator, while retainingindependent use of both functions.Flaperon SetupWhen using flaperon mixing, two servos (one foreach aileron) must be used. Connect the left aileronservo to channel #6 (Aux 1) and the right aileronservo to channel #2 (Aile) in the receiver. Individualfunctions (e.g., servo reversing, sub-trims, etc.) arestill available for each of the channels. Use sub-trimsfor individual neutral adjustment. Adjust the ailerontravel values by increasing or decreasing the ailerondual rate. Flap adjustments are made with flapleft/right travel adjustment described in Section 7.5.Also see Aileron Differential in Section 6.18.V-TailV-Tail Mixing requires two servos. Connect the lefttail servo to channel #3 (Elev) and the right tail servoto channel #4 (Rudd) in the receiver. Individualfunctions (e.g., servo reversing, sub-trims, etc.) areavailable for each servo. Use sub-trims for individualneutral adjustments described in Section 7.4. V-Tailelevator travel is adjusted by elevator dual ratesdescribed in Section 7.2.Delta-Wing MixingDelta or Elevon Mixing as it is commonly known, isthe final wing mixing selection in your XP652. Thisstyle of aircraft also employs two wing servos.However, in essence, there is not an elevator present.Instead, at an elevator stick input, the two wingservos function in conjunction with one another inthe same direction to create an up/down movementof the aircraft. Also, when an aileron control is given,the two wing servos move in opposite directions tofunction as ailerons as well.1. Press the SCROLL and INCREASE buttons upsimultaneously and hold.2. Turn on the transmitter to enter the System mode. 3. Press the SCROLL button until the “MIX WNG”appears on the screen.4. Press the CHANNEL button to select either theWing Type (WNG) or V-Tail (VTL) mode.5. Press the SCROLL button to access the ModelName function. 6. To exit, press the SCROLL and INCREASEbuttons up simultaneously.WING TYPE SELECTION6.4Press the SCROLLbutton until “MIX WING”appearson the screen.Press the CHANNELbutton to select Wing Type (WNG) or V-Tail (VTL) Mixing.Press the INCREASE or DESCREASE button to turn theFlaperon (FPR), Delta (DLT) or V-Tail (VTL) Mixing on or off.OF = OFFON = ONINDICATES WING TYPE FUNCTIONFPR = FLAPERONVTL = V-TAILDLT = DELTAWING = WING TYPE SELECTIONMIXOFCHANNELSCROLL INCREASEDECREASECHAPTER 6:FUNCTIONS (SYSTEM MODE) • Airplane3984 JR XP662 Manual 1/21/02 1:11 PM Page 25
26 XP662 MANUAL AirplaneCHAPTER 6:FUNCTIONS (SYSTEM MODE) • AirplaneWING TYPE SELECTION (continued)6.4To Activate Flaperon (FPR) Mixing (Wing Type Mode)To Activate Delta-Wing (DLT) Mixing (Wing Type Mode)1. In System Setup mode, pressthe SCROLL button until “MIXWNG”appears on the screen.2. Press the INCREASE buttonto activate Flaperon Mixing.OFFPRMIXOF = MIX OFON = MIX ONOFONDLTMIXMIX2. Press the CHANNELbutton once to accessthe V-Tail Mixing screen.DELTA WINGMIX ONOFONVTLMIXMIXTo Activate V-Tail (VTL) MixingNote: It is also possible toactivate both the Flaperon(FPR) and V-Tail (VTL) functionsto work simultaneously.1. In System Setup mode, pressthe SCROLL button until “MIXWNG”appears on the screen.2. Press the DECREASE buttonto activate Delta-Wing Mixing.1. In System Setup mode,press the SCROLLbutton until “MIX WNG”appears on the screen.3. Next press either the INCREASEor DECREASE buttons once toactivate V-Tail Mixing.CHANNELSCROLL INCREASEDECREASEENTERCHANNELSCROLL INCREASEDECREASEENTERCHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 26
27XP662 MANUAL AirplaneThe XP662 has memory for six models. It can storethe settings for six airplanes, six helicopters, or threeairplanes and three helicopters, etc.1. Press the SCROLL and INCREASE buttons simultaneously and hold.2. Turn on the transmitter to enter the system mode. 3. Press the SCROLL button until “MDL” appears on the screen.4. Press the INCREASE or DECREASE button toselect model number 1 through 6.5. Press the SCROLL button to access the ModelName entry function.6. To exit, press the SCROLL and INCREASE buttons simultaneously.Accessing the Model Selection FunctionMODEL SELECTION6.5IMDL INDICATES MODEL SELECTION FUNCTIONMODEL NUMBER 1 OR 21 THROUGH 6CHANNELSCROLL INCREASEDECREASEENTERIn System Setup mode, pressthe SCROLL button until “MDL”appears on the screen.Press the INCREASE or DECREASE button to selectmodel number 1–6.CHAPTER 6:FUNCTIONS (SYSTEM MODE) • Airplane3984 JR XP662 Manual 1/21/02 1:11 PM Page 27
28 XP662 MANUAL AirplaneCHAPTER 6:FUNCTIONS (SYSTEM MODE) • Airplane1. Press the SCROLL and INCREASE buttonssimultaneously and hold.2. Turn on the transmitter to enter the System mode.3. Press the SCROLL button until “AC1” appears on the screen.4. Press the INCREASE or DECREASE buttons to select the correct letter/number for the first character (flashing).5. To adjust the remaining two characters, press the CHANNEL button until the desired character to be adjusted is flashing.6. Press the SCROLL button to access theModulation Select function.7. To exit, press the SCROLL and INCREASEbuttons simultaneously.Accessing the Model Name Entry FunctionFlashing character includes character to be adjustedCURRENT MODELNUMBERIACIThe XP662 allows a three-digit name to be input foreach of the six models available. The current modelwill be displayed in the normal display. This featurehelps identify different aircraft types or model setups.MODEL NAME ENTRY6.6Press the CHANNELbutton to select thecharacter to bechanged (flashing).Press the INCREASE orDECREASE buttons toselect the desiredcharacter (A-Z, 1-9, etc.).In System Setup mode,press the SCROLL buttonuntil “MD1”appears on the screen.CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 28
29XP662 MANUAL Airplane1. Press the SCROLL and INCREASE buttonssimultaneously and hold.2. Turn on the transmitter to enter the System mode.3. Press the SCROLL button until “PPM” appears onthe screen.4. Press either the INCREASE or DECREASEbuttons to change the modulation to the desiredsetting FM (PPM), Z-PCM (ZPC) or S-PCM (SPC).5. Press the SCROLL button to access the ModelType function.6. To exit, press the SCROLL and INCREASEbuttons simultaneously.Accessing the Modulation Select FunctionPress the INCREASE or DECREASEbuttons to select the desired modulation.* Note: The modulation for the current model in use can be viewedat a glance by pressing the SCROLL button with the system in thenormal screen position.CURRENTMODULATION TYPEIPPMPress the SCROLL buttonuntil “PPM”appears. Current Model NumberMODULATION TYPESPPM (FM)SPC–SPCMZPC–ZPCMThe modulation select function enables your XP662to transmit to a variety of JR receivers that arealready, or may soon be, in existence. You can selectfrom either PPM (FM), Z-PCM or S-PCM,dependingon the central processing unit within your receiver toutilize existing receivers, or to upgrade your XP662flight pack for future models. Your system comesfactory preset in the FM or PPM (Pulse PositionModulation) position so that it is compatible withthe included R700 FM receiver.Please refer to the receiver compatibility chart below whenselecting the modulation type for various JR receivers.Note: Once the proper modulation has beenselected for a specific model number, themodulation type will remain the same for that modelnumber, even during model number/type changes. Inother words, if you have one model on FM/PPM andone model on PCM, the system will automaticallychange modulation types once the correctmodulation has been selected for that model.MODULATION SELECT6.7TX Modulation Compatible Receivers # of Channels & Brief DescriptionPPM (FM) NER-226 6 (micro)PPM (FM) NER-228 8PPM (FM) NER-327x 7PPM (FM) NER-527x 7 (micro)PPM (FM) NER-529x 9 (micro)PPM (FM) NER-549 9PPM (FM) NER-600 6 (micro)PPM (FM) NER-700 7 (Slimline)TX Modulation Compatible Receivers # of Channels & Brief DescriptionZ-PCM NER-236 6 (micro)Z-PCM NER-627XZ or627 “G” series7Z-PCM NER-J329P 9Z-PCM NER-910XZ 10S-PCM NER-D940S 10S-PCM NER-649S 9S-PCM NER-950S 10* Note: If either S-PCM or Z-PCM modulation is selected, pressingthe MODE button will access the Fail-Safe/Hold function.CHANNELSCROLL INCREASEDECREASEENTERCHAPTER 6:FUNCTIONS (SYSTEM MODE) • Airplane3984 JR XP662 Manual 1/21/02 1:11 PM Page 29
30 XP662 MANUAL AirplaneFAIL-SAFE/HOLD FUNCTION IN Z-PCM MODULATION6.9The Hold function is automatically activated whenthe radio is turned on and is in the Z-PCM modulation.This function stops (or holds) the servos in thepositions they were in just prior to the interference.Therefore, your airplane maintains the position heldimmediately before the interference was experienced.When a clear signal is restored, the Hold functionreleases, and control of the airplane returns to you.If you would prefer your control surfaces to move toa chosen position during a loss of signal, please referto the time delay/memory section below.Hold (Z-PCM)Accessing Fail-Safe/Hold (Z-PCM)When the Fail-Safe function is activated (i.e., whenthe signal is interrupted), the transmitter automaticallymoves each servo to a preset position. The positionthat each servo assumes is determined by you, as isthe time length of interference that must occurbefore servo movement.After the interference has ceased, control of theairplane returns immediately to you.There are three time delays to choose from: 1/3 (0.3)second, 1/2 (0.5) second and 1.0 second. These time delays are the amount of time it takes, starting themoment the interference occurs, until the servosassume their preset positions.1. Press the SCROLL and INCREASE button simultaneously and hold.2. Turn on the transmitter to enter the System mode.3. Press the SCROLL button until “FST” appears onthe screen.Note: If Fail-Safe does not appear on your LCD, it isbecause you are transmitting in PPM. Fail-Safe is notapplicable in the PPM mode. Refer to the ModulationMode Selection section for more information.The Fail-Safe/Hold function is available only whenyou use the XP662 transmitter in either of thePCM modulations: S-PCM or Z-PCM. This function isdesigned to help minimize damage to your airplaneduring a loss of signal to the receiver. The servoseither assume the fail-safe presets or hold the lastgood signal position.Note: In the PCM modulations, the Fail-Safe/Holdfunction cannot be totally disabled so that the servoswill react to interference in the same way as they do ina PPM system. This is only possible with the use of aPPM receiver and the transmitter in the PPM modulation.Note: Since the actual screen appearance varies,depending on the modulation of your radio, referto the appropriate modulation section which follows(Z-PCM, S-PCM).As noted earlier, if you are in the PPM modulation,the Fail-Safe/Hold function is not applicable.Therefore, the Fail-Safe/Hold function will not appearon your LCD in the PPM mode.Refer to the Modulation Selection section for moreinformation pertaining to the broadcast signal ofyour XP662 transmitter.FAIL-SAFE/HOLD6.8CHAPTER 6:FUNCTIONS (SYSTEM MODE) • Airplane3984 JR XP662 Manual 1/21/02 1:11 PM Page 30
31XP662 MANUAL AirplaneCHAPTER 6:FUNCTIONS (SYSTEM MODE) • AirplaneHO = ALL SERVOS HOLD0.3 = 1/3 SECOND TIME DELAY0.5 = 1/2 SECOND TIME DELAY1.0 = 1 SECOND TIME DELAYHOFSTSetting Fail-Safe/Hold Time Delay/Memory In Z-PCM ModulationPress either the INCREASE orDECREASE buttons to selectthe desired time delay.HOLD0.3 SECONDS0.5 SECONDS1.0 SECONDS1. After accessing the Fail-Safe function, it is now time to adjust the fail-safe time presets.2. Select among the three time delays (0.3, 0.5, or1.0 seconds) by pressing either the (+) or (-) buttonsuntil the desired setting appears on the screen.Note: If the Hold position (HO) is selected, thisfunction/screen will not be present.1. Press the SCROLL button until “FSM” appears onthe screen.2. Set all controls to the desired fail-safe position,then press the CHANNEL and INCREASE buttonssimultaneously. A high-pitch beep sound willconfirm that the preset positions have been entered.3. Hold the transmitter sticks in the position that you want the servos to assume during signal lossconditions. You can determine fail-safe preset positions for the other channels by placing the control knobs and switches in the positions that you want them to assume during interference.4. With the sticks, switches and control knobs in the fail-safe positions, press the CHANNEL andINCREASE buttons simultaneously. This willenter these locations as the fail-safe memorysettings. A high-pitched beep will indicate thatthis setting has been stored.5. To confirm that the input of data was successful, switch the transmitter off. The controls will moveto the input locations. If not, repeat Step 4 again.6. To exit the Fail-Safe function, press the SCROLLand INCREASE buttons simultaneously.Note: These preset positions remain stored in thetransmitter’s memory until both the transmitterbattery pack and the lithium back-up battery havebeen removed (or until data reset has been performed).Therefore, you do not have to reset the fail-safe eachtime you fly. Should you want to re-adjust the fail-safe presets, access the Fail-Safe function and adjustthe presets as you havejust done. The transmitterautomatically recalls the settings for the last fail-safe adjustment.CL WILL FLASH WHEN FAIL-SAFESERVO POSITIONS AREENTERED.CLFSMPress the CHANNEL and INCREASE buttonssimultaneously to store the fail-safe servo presets.FAIL-SAFE/HOLD FUNCTIOn IN Z-PCM MODULATION (continued)6.9Setting Servo Position PresetsCHANNELSCROLL INCREASEDECREASEENTERCHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 31
32 XP662 MANUAL AirplaneCHAPTER 6:FUNCTIONS (SYSTEM MODE) • AirplaneThe Hold function is automatically activated whenthe radio is turned on and in the S-PCM modulation.This function stops (or holds) the servos in thepositions they were in just prior to the interference.Therefore, your aircraft maintains the position heldimmediately before the interference was experienced.When a clear signal is restored, the Hold functionreleases, and control of the airplane returns to you.The XP662 allows you to combine the hold and fail-safe presets for all six channels on the receiver. Youcan select fail-safe or hold independently for allchannels on your aircraft. In other words, somechannels will hold their last clear signal position,while others assume the preset position. Once thefail-safe has been activated by signal interruption(interference), the transmitter automatically movesthe servos to a preset position. The predeterminedservo positions are set byyou. In the S-PCM fail-safe,the time delay (the amount of time it takes, startingthe moment the interference occurs, until the servosassume the preset positions) is fixed at .3, or 1/3, second.After the interference has ceased, normal operationof the airplane returns to you immediately.Hold Function (S-PCM)FAIL-SAFE/HOLD FUNCTION IN S-PCM MODULATION6.10Fail Safe/Hold Combination in S-PCM Modulation3984 JR XP662 Manual 1/21/02 1:11 PM Page 32
33XP662 MANUAL Airplane1. Press the MSCROLL button until “FSM” appearson the screen.2. Set all controls to the desired fail-safe positions. Next press the CHANNEL and INCREASE buttonsimultaneously. A-high pitch beep sound will confirmthat the preset positions have been entered and accepted.SERVO PRESET MEMORYCL WILL FLASH WHEN FAIL-SAFE SERVO POSITIONSARE ENTEREDCLFSMPress the CHANNEL andINCREASE buttonssimultaneously to store thedesired fail-safe presets/positions.Press the SCROLL andINCREASE buttonssimultaneously to exit thefunction mode.FAIL-SAFE/HOLD FUNCTION IN S-PCM MODULATION (continued)6.10Setting Servo Fail-Safe Presets in S-PCM ModulationFAIL SAFECURRENT CHANNELOF = HOLDON= PRESET SRVO POSITIONOFFS2Press the INCREASE orDECREASE buttons to activatethe preset position function.Press the CHANNELbutton to accesschannels 1-6.1. Press the SCROLL and INCREASE buttons simultaneously and hold.2. Turn on the transmitter to enter the system mode.3. Press the SCROLL button until “FS1” appears onthe screen. The #1 on the screen refers to thespecific channel (1-6) to be adjusted.4. Press the (+) or (-) button to activate (turn on)the preset position function for that channel.5. Press the CHANNEL button to move to the next channel(s) to be adjusted (2-6). Repeat Step 4 foreach channel to be activated.Note: If the Hold position (HO) is selected for all six channels, this function/screen will not be present.Activating Servo Fail-Safe Presets by Channel (S-PCM)CHAPTER 6:FUNCTIONS (SYSTEM MODE) • AirplaneCHANNELSCROLL INCREASEDECREASEENTERCHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 33
34 XP662 MANUAL AirplaneCHAPTER 7:FUNCTIONS (FUNCTION MODE) • AirplaneServo reversing is a very convenient function used inthe setup of a new aircraft. It is used to change thedirection of servo rotation in relation to thecorresponding stick movement. Servo reversing isavailable for all six channels.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.3. Press the SCROLL button until “REV-NORM”appears on the screen.4. Press the CHANNEL button until the desiredchannel appears on the screen.5. Press the INCREASE or DECREASE button tochange the servo direction.6. Press the SCROLL button to access the Dual Rate function.7. To exit, press the SCROLL and CHANNEL buttons simultaneously.Accessing the Servo Reversing FunctionSERVO REVERSING7.1THR : THROTTLEAIL : AILERONELE : ELEVATORRUD: RUDDERGER: LANDING GEARFLP : FLAP (AC ONLY)CHANNEL123456REV◆NORMTHRCHANNELSCROLL INCREASEDECREASEENTERPress the INCREASE orDECREASE button tochange the servo direction.Press the CHANNEL buttonuntil the desired channelappears on the screen.Press the SCROLLbutton until “REV/NORM”appears on the screen.3984 JR XP662 Manual 1/21/02 1:11 PM Page 34
CHANNELSCROLL INCREASEDECREASEENTER35XP662 MANUAL AirplaneDual rate is available for the aileron and elevatorchannels. The purpose of this function is to allow forin-flight selection of two preset servo travels for eachof these channels. The amount of travel is adjustablefrom 0-125%. The factory settings for both switchpositions (0 and 1) is 100%. Either position may beselected as the low or high rate by placing theswitches in the desired position and adjusting thevalue for that position. Operation of these switchesis described in Section 6.3.Different types of maneuvers require varyingamounts of control movements. Snap rolls requirelarge control movements, while smooth maneuverslike long slow rolls are best performed with smallercontrol movements. Dual rates allow you to changethe control movements in flight at the flip of aswitch. This allows you to execute maneuversrequiring both radical control movements and smallcontrol movements during a single flight.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.3. Press the SCROLL button until “D/R” appears on the screen.4. Press the CHANNEL button until the desiredchannel appears on the screen (AI = aileron or EL = elevator).5. The number that appears directly to the right ofthe selected channel is the switch position. Thereare two switch positions, 0 and 1, for each of thechannels. An “0” will appear when the selected dualrate switch is in the uppermost position and a “1”when the selected switch is in the lower position.6. To change the switch selection you must enterthe dual rate switch selection function in thesystem mode (see Section 6.3).7. The number in the center of the screen indicatesthe current dual rate value for the selectedswitch position and channel. Press theINCREASE or DECREASE button to adjust thedual rate value (0–125%).8. After adjusting the value for the 0-switchposition, change to the 1-switch position andadjust the rates.9. Press the CHANNEL button to select the otherchannel and adjust the dual rate value for bothswitch positions.10. Press the SCROLL button to access theExponential Rate feature.11. To exit, press the SCROLL and INCREASE buttons simultaneously.DUAL RATE7.2SWITCH POSITION (0 OR 1)DUAL RATE VALUE (0-125%)D/R AIOI00%INDICATES THE DUAL RATE FUNCTIONCHANNELAI : AILERONEL : ELEVATORAccessing the Dual Rate FunctionCHAPTER 7:FUNCTIONS (FUNCTION MODE) • AirplanePress the SCROLL button until“D/R”appears on the screen.Press the CHANNEL button until“AI”or “EL”appears on the screen.Press the INCREASE or DECREASEbutton to adjust the dual rate value.3984 JR XP662 Manual 1/21/02 1:11 PM Page 35
36 XP662 MANUAL AirplaneCHAPTER 7:FUNCTIONS (FUNCTION MODE) • AirplaneProgrammable exponential adjustments are offeredon the aileron and elevator channels of your XP662system. Exponential is a function that allows you totailor the response rate of the controls as comparedto the stick inputs. The purpose of exponential is toreduce the sensitivity in the middle portion of stickmovement, while still allowing full travel at the endof the stick movement. In other words, the end result(travel) remains the same, although exponentialchanges the rate at which it achieves this travel.The adjustable range of the Exponential function isfrom 0–100%. Zero percent (0%) is linear stick controlwhich means that the response rate is equalthroughout the stick control. One hundred percent(100%) is full exponential. The larger the exponentialvalue, the less servo action, or sensitivity, you willnotice around the neutral setting.Note: The Exponential function operates inconjunction with the Dual Rate function. It isimperative to understand the Dual Rate functionprior to adjusting the exponential values.Exponential may be selected independently foreither the high or low rate (position 0 or 1) or both.EXPONENTIAL7.3Accessing the Exponential Function1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the Function mode.3. Press the SCROLL button until “EXP” appears atthe left side of the screen.4. Press the CHANNEL button until the desired channel appears on the screen (AI or EL).5. Using the appropriate dual rate switch, select the correct position to be adjusted (0 or 1).6. Press the (+) or (-) buttons to increase/decrease the exponential value.7. Press the SCROLL button to access the Sub-Trim function.8. To exit, press the SCROLL and INCREASEbuttons simultaneously.SWITCH POSITIONAI = AILERONEL = ELEVATOREXPONENTIAL VALUE 0%AIOPress the INCREASE andDECREASE buttons toincrease/decrease theexponential value (0–100%).Press the SCROLLbutton until “EXP”appears on the leftside of the screen.Note: The dual rate switch position ischanged/accessed by setting the appropriatedual rate switch to the 0 or 1 positions.Press the CHANNELbutton to select eitheraileron or elevatorexponential.EXPA GOOD STARTING POINTFOR EXPONENTIAL VALUE ISAPPROXIMATELY 20–30%.CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 36
37XP662 MANUAL AirplaneAccessing the Sub-Trim FunctionSB-TRIM THR0THR : THROTTLEAIL : AILERONELE : ELEVATORRUD: RUDDERGER: LANDING GEARFLP : FLAP (AC ONLY)CHANNEL123456INDICATES THE SUB-TRIM FUNCTIONSUB-TRIM VALUE (±125)Sub-trim is an electronic trim that is available foreach of the six channels. Sub-trim is particularlyuseful as it allows the mechanical trim levers to bereturned to their neutral positions by adjusting/changing the servo’s neutral position electronically,without the need to mechanically adjust the specificcontrol linkage. This allows the same mechanicaltrim lever settings between the four models you cancontrol with this radio system. Sub-trim can alsoallow additional trim travel when mechanical trimsdo not provide enough movement.Note: It is recommended to use as little subtrim aspossible for adjustment. If more that 20–30 pointsare required, is it suggested that a mechanicallinkage adjustment be performed.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.3. Press the SCROLL button until “SB-Trim”appears on the screen.4. Press the CHANNEL button until the desiredchannel appears on the screen.5. Press the INCREASE or DECREASE button toestablish the desired amount of sub-trim.6. Press the SCROLL button to access the traveladjustment function.7. To exit, press the SCROLL and INCREASE buttons simultaneously.SUB-TRIM 7.4CHAPTER 7:FUNCTIONS (FUNCTION MODE) • AirplaneCHANNELSCROLL INCREASEDECREASEENTERPress the SCROLLbutton until “SB-TRIM”appears on the screen.Press the CHANNEL buttonuntil the desired channelappears on the screen.Press the INCREASE orDECREASE button toadjust the sub-trim value.3984 JR XP662 Manual 1/21/02 1:11 PM Page 37
38 XP662 MANUAL AirplaneCHAPTER 7:FUNCTIONS (FUNCTION MODE) • AirplaneThe amount of servo travel is adjustable for eachdirection for each of the six channels individually.The adjustment range is from 0% to 150%. Traveladjustment is factory set at 100% for all channels.The travel adjustment value displayed on the screendepends on the position of the stick or switch (e.g.,flap switch, gear switch). This function is usefuleither to maximize control surface travel, or toreduce travel to eliminate servo binding without theneed for mechanical adjustment.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.3. Press the SCROLL button until “TRV ADJ.”appears on the screen.4. Press the CHANNEL button until the desiredchannel appears on the screen.5. Move the selected channel stick or switch in thedirection that you want to adjust the travel. Pressthe INCREASE or DECREASE button to achieve the desired travel. Move the stick in the oppositedirection to adjust the travel in the opposite direction.6. The same may be done for all channels.7. Press the SCROLL button to access the aileron- to-rudder mixing function.8. To exit, press the SCROLL and INCREASE buttons simultaneously.TRV ADJ. THR+I00%THR : THROTTLEAIL : AILERONELE : ELEVATORRUD: RUDDERGER: LANDING GEARFLP : FLAP (AC ONLY)CHANNEL123456INDICATES THE TRAVELADJUSTMENT FUNCTIONTRAVEL ADJUSTMENT VALUESERVO OPERATING DIRECTIONAccessing the Travel Adjustment FunctionTRAVEL ADJUSTMENT7.5CHANNELSCROLL INCREASEDECREASEENTERPress the SCROLLbutton until “TRV ADJ.”appears on the screen.Press the CHANNEL buttonuntil the desired channelappears on the screen.Press the INCREASE or DECREASE button to adjustthe travel adjustment value.3984 JR XP662 Manual 1/21/02 1:11 PM Page 38
39XP662 MANUAL AirplaneOn some types of aircraft, it is desirable to mixaileron and rudder to make coordinated turns. TheXP662 allows the mixing of aileron-to-rudder andallows you to adjust the amount and direction ofmixing. The aileron-to-rudder mixing can be left onall the time, or it can be turned off with the selectionof one of three switches.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the Function mode.3. Press the SCROLL button until “MIX A-R”appears on the screen.4. Press the CHANNEL and INCREASE button toset the desired amount and direction of aileron-to- rudder mixing.Note: If “OF” appears on the screen, it isbecause the aileron to rudder mixing switch is in the off position.Accessing the Aileron-to-Rudder Mixing FunctionAILERON-TO-RUDDER MIXING7.6MIX A-R+0%MIXING VALUE (0-125%)INDICATES THE AILERON TORUDDER MIXING FUNCTIONMIXING DIRECTION Press the INCREASE and DECREASE buttons simultaneously to set the CHAPTER 7:FUNCTIONS (FUNCTION MODE) • AirplaneCHANNELSCROLL INCREASEDECREASEENTERPress the SCROLLbutton until “MIX A-R.”appears on the screen.Press the CHANNEL and INCREASEbuttons simultaneously to set the aileronto rudder mixing direction.Press the INCREASE or DECREASE button to set theaileron to rudder mixing value.3984 JR XP662 Manual 1/21/02 1:11 PM Page 39
40 XP662 MANUAL AirplaneCHAPTER 7:FUNCTIONS (FUNCTION MODE) • Airplane1. Follow Steps 1 through 4 as on the previous page.2. Press the CHANNEL button until “MIX ARS”appears on the screen.3. Press the INCREASE or DECREASE button untilthe desired switch selection appears on the screen.4. Press the SCROLL button to access the elevator-to-flap mixing function.5. To exit, press the SCROLL and INCREASE buttons simultaneously.Accessing the Aileron-to-Rudder Mixing Switch FunctionAILERON-TO-RUDDER MIXING (continued)7.6MIX ARSON MIXING SWITCHON = MIXING IS ALWAYS ACTIVATEDS = GEAR SWITCHA = AILERON DUAL RATE SWITCHF1 = FLAP SWITCHINDICATES THE AILERON TORUDDER MIXING SWITCH FUNCTIONNCHANNELSCROLL INCREASEDECREASEENTERPress the CHANNEL button until“MIX-ARS”appears on the screen. Press the INCREASE or DECREASEbutton until the desired switch selectionappers on the screen.Aileron-to-Rudder Mixing Switch Selection3984 JR XP662 Manual 1/21/02 1:11 PM Page 40
41XP662 MANUAL AirplaneElevator-to-flap mixing is commonly used to quickenthe pitching rate of an aircraft. This is very popular infun fly airplanes because it allows tighter loops.Normally, with up elevator the flaps go down, whiledown elevator makes the flaps go up.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.3. Press the SCROLL button until “MIX E-F” appears on the screen.4. Press the CHANNEL and INCREASE buttonssimultaneously to set the elevator-to-flap mixing direction.5. Press the INCREASE or DECREASE button to set the elevator-to-flap mixing value.Accessing the Elevator-to-Flap Mixing FunctionELEVATOR-TO-FLAP MIXING7.7MIX E-F+0%MIXING VALUE (0-125%)INDICATES THE-ELEVATOR-TOFLAP MIXING FUNCTIONMIXING DIRECTION Press the INCREASE and DECREASEbuttons simultaneously to set thelttfl iiditiCHAPTER 7:FUNCTIONS (FUNCTION MODE) • AirplaneCHANNELSCROLL INCREASEDECREASEENTERPress the SCROLLbutton until “MIX E-F.”appears on the screen.Press the CHANNEL and INCREASEbuttons simultaneously to set the elevatorto flap mixing direction.Press the INCREASE or DECREASE button to set theelevator-to-flap mixing value.3984 JR XP662 Manual 1/21/02 1:11 PM Page 41
42 XP662 MANUAL AirplaneCHAPTER 7:FUNCTIONS (FUNCTION MODE) • Airplane1. Follows Steps 1 through 4 as on the previous page.2. Press the CHANNEL button until “MIX EFS”appears on the screen.3. Press the INCREASE or DECREASE button until thedesired switch designation appears on the screen.4. Press the SCROLL button to access thedifferential function if flaperons or delta-wingtypes are activated in the system mode. If flaperonsare not activated, pressing the SCROLL buttonwill access the flap-to-elevator offset function.5. To exit, press the SCROLL and INCREASE buttons simultaneously.Accessing the Elevator-to-Flap Mixing Switch FunctionELEVATOR-TO-FLAP MIXING (continued)7.7MIX EFSON MIXING SWITCHON = MIXING IS ALWAYS ONS = LANDING GEAR SWITCHE = ELEVATOR DUAL RATEF0 = FLAP SWITCHINDICATES THE ELEVATOR-TO-FLAPMIXING SWITCH FUNCTIONNCHANNELSCROLL INCREASEDECREASEENTERPress the CHANNEL button until“EFS”appears on the screen. Press the INCREASE or DECREASEbutton until the desired switch designationappers on the screen.Elevator-to-Flap Mixing Switch Selection3984 JR XP662 Manual 1/21/02 1:11 PM Page 42
43XP662 MANUAL AirplaneAccessing the Differential Function • Flaperon/Delta Mode OnlyMIX DIF0%DIFFERENTIAL VALUE (0 TO 100%)INDICATES THE DIFFERENTIAL FUNCTIONAileron differential is used to correct roll to yawcoupling and adverse yaw characteristics. In order toactivate differential, the flaperon wing type must havebeen selected in the system mode (see Section 6.4).Also, each aileron control surface must have its ownservo with the right aileron servo plugged into theaileron channel (#2) on the receiver and the leftaileron servo plugged into the Flap Aux 1 channel (#6)on the receiver.1. Turn on the transmitter.2. Flaperon wing type must be selected (see Section 6.4).3. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.4. Press the SCROLL button until “MIX DIF”appears on the screen.5. Press the INCREASE or DECREASE button toadjust the differential mixing value.6. Press the SCROLL button to access the flap-to-elevator offset trim function.7. To exit, press the SCROLL and INCREASE buttons simultaneously.DIFFERENTIAL7.8CHAPTER 7:FUNCTIONS (FUNCTION MODE) • AirplaneCHANNELSCROLL INCREASEDECREASEENTERPress the SCROLL button until“MIX DIF”appears on the screen. Press the INCREASE or DECREASEbutton to adjust the differential value.3984 JR XP662 Manual 1/21/02 1:11 PM Page 43
44 XP662 MANUAL AirplaneCHAPTER 7:FUNCTIONS (FUNCTION MODE) • AirplaneWhen the flaps are deployed, most airplanes exhibitpitching tendencies (most pitch nose up). Elevatoroffset trim is designed to prevent this pitching. Flapto elevator offset trim automatically retrims the elevatorto a preset value when the flap switch is activated.Note: Flap-to-elevator offset trim is also useful as adual elevator trim even for airplanes without flaps. Thisis especially helpful for sailplanes that require one trimsetting for launch and another trim setting for flight.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.3. Press the SCROLL button until “OFFSET F-E”appears on the screen.4. Press the INCREASE or DECREASE button to setthe desired amount and direction of the elevator offset. Note: It is helpful to have the flap switch on when making this adjustment.5. Press the SCROLL button to access theProgrammable Mix function.6. To exit, press the SCROLL and INCREASE buttons simultaneously.Accessing the Flap-to-Elevator Offset Trim FunctionFLAP-TO-ELEVATOR OFFSET TRIM7.9OFFSETF-E0ELEVATOR OFFSET VALUE (±125)INDICATES FLAP-TO-ELEVATOROFFSET TRIM FUNCTIONCHANNELSCROLL INCREASEDECREASEENTERPress the SCROLL button until“OFFSET F-E”appears on the screen. Press the INCREASE or DECREASE buttonto adjust the flap-elevator offset value.3984 JR XP662 Manual 1/21/02 1:11 PM Page 44
CHANNELSCROLL INCREASEDECREASEENTER45XP662 MANUAL AirplaneThe XP662 in aircraft mode offers threeprogrammable mixes to be used for a number ofdifferent purposes. The functions allow mixing anyone channel to any other channel.The mix can remain ON at all times, or be switchedOFF in flight using a number of different switches.(Refer to Chart A). Each channel is identified bychannel numbers 1-6 (i.e., 2 = aileron, 4 = rudder,etc.—See Chart B) The channel appearing first isknown as the “master channel,” or the channel towhich you want to mix. The second channel is knownas the “slave channel” or the channel that is beingmixed into the master channel. For example, “AILE-RUDD” would indicate aileron-to-rudder mixing.Each time the aileron stick is moved, the aileron willdeflect, and the rudder will automatically move inthe direction and to the value input. Mixing isproportional, so small inputs of the master channelwill produce small outputs of the slave channel.Each programmable mix has a mixing “offset.” Thepurpose of the mixing offset is to redefine theneutral position of the slave channel.PROGRAMMABLE MIXING (A,B,C)7.10Accessing the Programmable Mixing Function1. Turn on the transmitter2. Press the SCROLL and INCREASE buttons simultaneously to enter the Function mode.3. Press the SCROLL button until “MIX A11”appears at the top right corner of the screen. Thisis Program Mix A. Pressing the SCROLL buttonagain will select mixes B and C.A B CON ON ONF1 F1 F1A AE EFO5MIXChart A Switch SelectionSWITCHAlways ONFlap/Mix SwitchPosition 1 ONAileron DIR SwitchElevator DIR SwitchFlap/Mix Switch Position O ONGear/Mix SwitchFUNCtIONThrottleAileronElevatorRudderGearFlapChart B Channel NumbersCHANNEL NUMBER1234560%AIIPress the SCROLL buttonuntil “MIX A11”appears.CURRENT MIXCURRENTMIXCHANNELSMIXCHAPTER 7:FUNCTIONS (FUNCTION MODE) • Airplane3984 JR XP662 Manual 1/21/02 1:11 PM Page 45
CHANNELSCROLL INCREASEDECREASEENTERCHANNELSCROLL INCREASEDECREASEENTER46 XP662 MANUAL AirplaneCHAPTER 7:FUNCTIONS (FUNCTION MODE) • Airplane1. Press the CHANNEL button once until “MIX ASW” appears.2. Press the INCREASE or DECREASE button toselect the switch to be used to activate themixing or leave on if a constant mix is desired.(Refer to Chart A on the preceding page forpossible mix/switch selections.)1. Press the channel button twice until “MIX A CH”appears on the screen.2. Press the (+) button to select the desired Master Channel (1-6).3. Press the (-) button to select the desired Slave Channel (1-6). Refer to Chart B on the precedingpage for channel number clarification.PROGRAMMABLE MIXING (A,B,C) (continued)7.1024ACHPress the CHANNELbutton until “MIX A ch”appears.Press INCREASEto select MasterChannel desired.Press DECREASEto select SlaveChannel desired.MASTERCHANNELSLAVECHANNELMIXAssigning ChannelsONA5WPress the CHANNEL buttonuntil “MIX ASW”appears. Press the INCREASE or DECREASE buttonsto select the desired switch to be activated(refer to Chart A on preceding page).SWITCHCHOICESONF1AEFO5MIXSwitch SelectionN3984 JR XP662 Manual 1/21/02 1:11 PM Page 46
CHANNELSCROLL INCREASEDECREASEENTERCHANNELSCROLL INCREASEDECREASEENTER47XP662 MANUAL Airplane1. Press the CHANNEL button once until “MIX A” appears, with the mixing value located at the bottom of the screen.2. To set the Slave Channel’s mixing value, moveand hold the Master Channel control stick to the direction to be adjusted (up/down—left/right), then press the INCREASE key to add positivemixing, value, or the DECREASE key to addnegative mixing value (+/–125%). When themaster channels stick is moved, the display willautomatically show the mixing value for thecurrent stick direction. Note: If a mix switch position other than on isselected, it will be necessary to move the selectedswitch to the on (or active) position to adjust themixing value. “OF” will appear on the screen if theselected mixing switch is in the off position.The purpose of the mixing offset feature is toredefine the neutral position of the slave channel tobe mixed. Any desired position may be selected forthe offset reference point. To set the offset position,place the master channel’s stick to the desiredposition and press either the INCREASE orDECREASE keys. This position is now stored in the memory and itsoffset value from the neutral position of the masterchannel is indicated numerically on the LCD display.Then, the mixing value at the determined offsetposition is now set at 0.PROGRAMMABLE MIXING (A,B,C) (continued)7.100%A24Press the CHANNELbutton once until “MIX A”and MIX value % appearsPress either the INCREASE or DECREASEbuttons to increase/decrease mixing value.CURRENT MIX MASTER CHANNELSLAVECHANNELCURRENTMIXINGVALUEMIX0A24Press the CHANNEL button until“OFFSET”appears on the screen. Press either the INCREASE orDECREASE buttons to slave theoffset position.OFFSET MIXINGVALUEMIXOFFSETMixing Value AdjustmentMixing Offset AdjustmentAccessing the Offset FunctionCHAPTER 7:FUNCTIONS (FUNCTION MODE) • Airplane1. Press the CHANNEL button once until offset appears in the center of the screen.2. Place the master channel stick to the desired position of slave channel offset, then press eitherthe INCREASE or DECREASE button to store.3. Press the SCROLL button once to accessProgram Mix B, press twice to access programMIX C, and a third time for servo reversing. 4. To exit the Function mode, press the SCROLLand INCREASE buttons simultaneously.Note: If a mix switch position other than on hasbeen selected, it will be necessary to move theselected switch to the on or active position to set theoffset value. “OF” will appear on the screen if theselected mixing switch is in the off position.3984 JR XP662 Manual 1/21/02 1:11 PM Page 47
48 XP662 MANUAL AirplaneData SheetCHAPTER 8:DATA SHEET • Airplane8NORM NORM NORM NORM NORM NORM••••• •REV REV REV REV REV revSUB-TRIM TRAVEL ADJUST + % + % + % + % + % + %(TRV ADJ.) - % - % - % - % - % -%REVERSE SWCHANNELS THRO (1) AIL (2) ELE (3) RUDD (4) GER(5) AUX1 (6)FAIL-SAFE TIME (ZPCM) AILE (AI) ELEV (EL)D/R % %EXP % %D/R % %EXP % %POS OPOS 1MIX SW POSON • 5 • A • F1 %ON • 5 • E • F0 %AILE RUDD MIXDUAL RATE • EXPD/R SW EA • A • E • CFLANDING ELEV OFFSETWING TYPEPROG. MIXABCCHANNELMASTER SLAVE MIX SWITCH OFFSET +GAIN -GAINON • F1 • A • EON • F1 • A • EON • F1 • F0 • 5V-TAILDIFFERENTIALON • OFF%NORM•FLAPERON• DELTA±ELEV FLAP MIXModulation SPCM • ZPCM • PPM (FM)Model Number _____________________Model Name ______________________3984 JR XP662 Manual 1/21/02 1:11 PM Page 48
AUX 1/FLAP MIXINGAILERON DUAL RATEANTENNALCD SCREENGEAR SWITCHELEVATOR DUAL RATETRAINER BUTTONAILERON/ELEVATOR STICKTHROTTLE/RUDDER STICKPOWER SWITCHAILERON TRIMELEVATOR TRIMTHROTTLE TRIMRUDDER TRIMNECK STRAP EYELETINPUT KEYSCARRYING HANDLETHROTTLE CUT BUTTON49XP662 MANUAL Helicopter1. THRO Throttle Channel2. AILE Aileron Channel3. ELEV Elevator Channel4. RUDD Rudder Channel5. GEAR Gear Channel6. AUX 1 Auxiliary 1 Channel (Pitch)Transmitter Throttle ALTThe Throttle ALT function makes the throttle sticktrim active only when the throttle stick is less thanhalf throttle. This gives easy, accurate idle adjustmentswithout affecting the high throttle position.RECEIVER CHANNEL ASSIGNMENT/TRANSMITTER THROTTLE ALT1.2CONTROL IDENTIFICATION AND LOCATION • Mode II1.1CHAPTER 1:TRANSMITTER CONTROLS • Helicopter 3984 JR XP662 Manual 1/21/02 1:11 PM Page 49
50 XP662 MANUAL HelicopterCHAPTER 1:TRANSMITTER CONTROLS • Helicopter CRYSTALCARRYING HANDLETRAINER JACKBATTERYTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER CASE SCREWTRANSMITTER REAR1.3Note: Your transmitter has a 5-year lithium batteryto protect your pre-programmed data against maintransmitter battery failure. If you system reads 0.0 volts, or has an unfamiliar display (service mode)or your data resets to the factory defaults, return yourtransmitter to Horizon Service Center (see page 85)for lithium battery replacement.(Factory Installed)Transmitter Crystal Replacement NoticeThe Federal Communications Commission (FFC) requires thatchanges in transmitter frequency must be performed only by anauthorized service technician (Horizon Service Center). Anytransmitter frequency change made by non-certified technicianmay result in a violation of the FCC rules.3984 JR XP662 Manual 1/21/02 1:11 PM Page 50
51XP662 MANUAL HelicopterDIRECT SERVO CONTROL (DSC)1.5CONTROL STICK LENGTH ADJUSTMENTCHAPTER 1:TRANSMITTER CONTROLS • Helicopter 1.4NECK STRAP ATTACHMENT1.6To adjust the control stick length, use a 2mm Allenwrench to unlock the set screw located inside theend of the control stick. Turn the set screwcounterclockwise to loosen it, then turn the knurledportion of the stick to adjust the length.Counterclockwise will lengthen the stick andclockwise will shorten it. After the control stick(s)has been adjusted to suit your flying style, tightenthe set screw back.For proper DSC hook-up and operation:1. Leave the transmitter power switch off. The transmitter will not transmit any radio frequency(RF) in this position.2. Plug the optional DSC Cord (JRPA132) into the DSC port in the rear of the transmitter.3. The encoder section of the transmitter will now be operational and the LCD display will be lit.4. Plug the other end of the DSC Cord into the receivercharge receptacle. Turn on the switch harness.Note: When installing the optional Charging Jack (JRPA025), be sure to hook the charging jackreceptacle securely into the switch harness charge cord.Why you should use the DSC function:1. The DSC enables you to check the control surfaces of your aircraft without drawing the fully operational 200mAh from your transmitter battery pack. Instead, you will only draw 70mAh when using the DSC function.Note: You will need to purchase (separately) both the DSC Cord (JRPA132) and the JR DeluxeSwitch Harness (JRPA001) to make use of the XP662 DSC Function.2. The DSC function allows you to make final adjustments to your airplane or helicopter without transmitting any radio signals. Therefore, if another pilot is flying on your frequency, you can still adjust your aircraft and not interfere with the other aircraft.Note: Under no circumstances should you attemptto fly your aircraft with the DSC Cord plugged in!This feature is for bench checking your aircraft only.There is an eye hook on the front of the transmitterfor attaching an optional Neck Strap (JRPA023). Theeye hook is precisely positioned (see Section 1.1) sothat the transmitter will be perfectly balanced whena neck strap is used.LOOSENTIGHTENSET SCREWABCA—Charge Cord/DSC ReceptacleB—Switch Harness LeadC—Charger/DCS Cord3984 JR XP662 Manual 1/21/02 1:11 PM Page 51
52 XP662 MANUAL HelicopterPlease read and carefully follow these suggestions.1. For added protection, wrap the RX and the RXNi-Cd in foam rubber that is at least 1/4” thick.2. Run the RX antenna through the fuselage andmake sure it is fully extended. Never cut orbundle your RX antenna—this will decreaserange and performance.3. Rubber servo grommets are included with yourradio system and should be installed in the servoflanges. The servos should then be mounted oneither hardwood rails or a plywood tray with themounting screws provided. Do not overtightenthe mounting screws. The flange of the brasseyelets should face down (toward the wood).4. All servos must be able to move freely over thefull range of their travel. Make sure the linkagesdo not impede servo travel. A stalled servo willdrain the battery pack within a few minutes.5. Before installing servo output arms, make surethe servo is in its neutral position.6. In the case of gas-powered model aircraft, mountthe receiver power switch on the side of thefuselage opposite the muffler to protect theswitch from exhaust residue. With other types of models, mount the switch in the mostconvenient place. Make sure that the switchoperates freely and is capable of traveling its full distance.7. With your model on the ground and the trans-mitter antenna collapsed, check that yoursystem works at a distance of 75 to 100 feet.If your system stops functioning at a distancethat is shorter than listed above, please contactthe Horizon Service Center for furtherinformation prior to flying your model.INSTALLATION REQUIREMENTSCHAPTER 2:CONNECTIONS • HelicopterCONNECTIONS2.22.1ONOFFRUDDERELEVATORAILERONTHROTTLEON/OFF SWITCH HARNESS(JRPA003)CHARGING PLUGRECEIVERBATTERYB1000 PITCHGEAR7 CH 72MHz FM SLIMLINERECEIVERABC&W INTERFERENCEPROTECTION SYSTEMBATTRUDDELEVAILETHROAUX1R700 RECEIVERANTENNAG460TGYRO(OPTIONAL)R700 RECEIVER3984 JR XP662 Manual 1/21/02 1:11 PM Page 52
53XP662 MANUAL HelicopterBATTERY ALARM AND DISPLAYCHAPTER 4:BATTERY ALARM AND DISPLAY • Helicopter4CHAPTER 3:KEY INPUT AND DISPLAY • HelicopterWhen the transmitter battery drops below 9.0 volts,the display will start to flash BAT and an audiblealarm will sound for eight beeps. These warningsmean you should land your aircraft immediately. Note: During the period that the battery alarm is flashing, the input buttons will not function. If youare currently in the function mode, the transmitterwill exit automatically and return to the normaldisplay (see Section 5.1).BAT8.9VFLASHINGVKEY INPUT AND DISPLAY3Two input keys are located at the lower right and leftfaceplate of the XP662 transmitter. The keys are usedto access and program the transmitter. Each key canbe moved up or down using your thumbs.CHANNELSCROLL INCREASEDECREASEENTERLeft button up........SCROLL — Used to advancethrough the menusLeft button down...CHANNEL — Used to advance through the channels or featuresin a given functionRight button up........INCREASE — Increases valueor changes setting (e.g., Reverse Normal)Right button down...DECREASE — Decreasesvalue or changes setting.(e.g., Reverse Normal)3984 JR XP662 Manual 1/21/02 1:11 PM Page 53
54 XP662 MANUAL HelicopterSYSTEM MODECHAPTER 5:INPUT MODE AND FUNCTION • Helicopter5.2NORMAL DISPLAY5.1When the power switch is turned on, the screen willread as shown here in the diagram. This screen isreferred to as the normal display.To enter the System mode, press the SCROLL andINCREASE buttons simultaneously while you turn onthe transmitter. You can now select any of eightsystem mode functions shown here in the flow chart.To exit the System mode, press the SCROLL andINCREASE buttons simultaneously or turn off thetransmitter. Press the SCROLL button to movethrough the system mode functions. Information foreach function is located on the page number listednext to the function name.I0.4VHE I MODEL NUMBERAC = FIXED WING AIRCRAFTHE = HELICOPTERBATTERY VOLTAGEIMDLIHEIISPCHOFSTHETYPHERSTE.ASWD/RFGEROFFSIMODEL TYPE SELECTIONPage 56DATA RESET Page 57DUAL RATE SWITCHSELECTION Page 58GEAR/GYRO GAIN SWITCH SELECTION Page 59MODEL SELECTION Page 60MODEL NAME ENTRYPage 61MODULATION SELECTPage 63Page 65* (S-PCM)* (Z-PCM)FAIL-SAFEFAIL-SAFE MEMORYVPage 68Only visible when modulation typeis selected for SPCM or ZPCMPCM modulation is selected3984 JR XP662 Manual 1/21/02 1:11 PM Page 54
55XP662 MANUAL HelicopterFUNCTION MODECHAPTER 5:INPUT MODE AND FUNCTION • Helicopter5.3To enter the Function mode, turn on the transmitter.Press the SCROLL and INCREASE buttonssimultaneously until a beep is heard. The display willchange accordingly and show the last activefunction. Press the SCROLL button to scroll downthrough the functions one by one as shown in theflowchart at right. Once the appropriate function isselected, use the CHANNEL button to select theappropriate channel. Use the INCREASE andDECREASE buttons to adjust the values displayedon the screen.THR-REV•NORM SERVO REVERSING Page 67DUAL RATE Page 68EXPONENTIAL Page 69SUB-TRIM Page 70TRAVEL ADJUSTMENT Page 71THROTTLE HOLD Page 72PITCH CURVE (NORMAL)Page 73PITCH CURVE (STUNT)Page 73PITCH CURVE (HOLD) Page 73THROTTLE CURVE (NORMAL)Page 74THROTTLE CURVE (STUNT)Page 74REVOLUTION MIXING Page 75PROGRAMMABLE MIXING APage 76CCPM SWASHPLATE MIX Page 79I00%AIOD/R0%AIOEXP+I00%THRTRV ADJHLD00FPLN0%PLSMIX0%PLH0%TLN0%TL50%RVU0%AIIMIX0%CCPMIX OFTHRSB-TRIMMIXOnly visible when throttlehold function is activated3984 JR XP662 Manual 1/21/02 1:11 PM Page 55
56 XP662 MANUAL HelicopterAccessing the Model Type Selection FunctionCHAPTER 6:FUNCTIONS (SYSTEM MODE) • HelicopterHETYP INDICATES MODEL TYPESELECTION FUNCTIONMODEL TYPEAC = AIRPLANEHE = HELICOPTERTwo types of aircraft programming are available withthe XP662, airplane (AC) and helicopter (HE). Whenyou enter the model type selection function, thecurrent model type will appear on the screen. (Thecurrent model type being the factory preset or thelast model used.) When you press the increase ordecrease button to change the model type, the newmodel type indicated on the screen will flash. Forexample, if the current model type is AC and youchange to HE, “HE” will flash on the screen. Theflashing alerts you to the change of model type andwill stop once you move to the next function or exitthe system mode.1. Press the SCROLL and INCRESE buttons simultaneously and hold.2. Turn on the transmitter to enter the system mode.3. Press the SCROLL button until “TYP” appears on the screen.4. Press the INCREASE or DECREASE button untilthe desired model type appears on the screen (AC = airplane HE = helicopter).5. Press the SCROLL button to access the DataReset function.6. To exit, press the SCROLL and INCREASE buttons simultaneously.MODEL TYPE SELECTION6.1CHANNELSCROLL INCREASEDECREASEENTERPress the SCROLL button until“TYP”appears on the screen. Press either the INCREASE or DECREASEbuttons until the desired model type (AC or HE)appears on the screen.3984 JR XP662 Manual 1/21/02 1:11 PM Page 56
57XP662 MANUAL HelicopterHERST INDICATES DATA RESET FUNCTIONMODEL TYPE TO RESETAccessing the Data Reset FunctionCHAPTER 6:FUNCTIONS (SYSTEM MODE) • HelicopterThe Data Reset function allows you to reset all theprogramming in the selected model (1-6) to thefactory settings. Before using the data reset functionit is important to enter the Model Selection functionand check that the current model number (1-6)indicated is the model that you want to reprogram tothe factory settings. The model selection function isdescribed in Section 6.5.1. Press the SCROLL and INCREASE buttons simultaneously and hold.2. Turn on the transmitter to enter the system mode.3. Press the SCROLL button until “RST” appears on the screen. 4. Press the CHANNEL and INCREASE buttonssimultaneously to reset the data. (To confirmthat the selected model's programming has beenreset, a beep will sound and the “AC” or “HE” willmomentarily disappear from the screen.)5. Press the SCROLL button to access the DualRate switch selection function.6. To exit, press the SCROLL and INCREASEbuttons simultaneously.DATA RESET6.2CHANNELSCROLL INCREASEDECREASEENTERIn System Setup mode, pressthe SCROLL button up until“RST”appears on the screen. Press the CHANNEL button down andINCREASE button up simultaneously toreset the data (a beep will sound).3984 JR XP662 Manual 1/21/02 1:11 PM Page 57
58 XP662 MANUAL HelicopterAccessing the Dual Rate Switch Selection FunctionCHAPTER 6:FUNCTIONS (SYSTEM MODE) • HelicopterE.ASW INDICATES DUAL RATE SWITCH FUNCTIONINDICATES SWITCH POSITIONE.A = ELEVATOR AND AILERON OPERATE INDIVIDUALLYA. = OPERATION OF ELEVATOR AND AILERON DUAL RATE ON AILERON DUAL RATE SWITCHE. = OPERATION OF ELEVATOR AND AILERON DUAL RATE ON ELEVATOR DUAL RATE SWITCHCF = OPERATION OF ELEVATOR AND AILERON DUAL RATE ON FLIGHT MODE SWITCHD/R1. Press the SCROLL and INCREASE buttons simultaneously and hold.2. Turn on the transmitter to enter the system mode. 3. Press the SCROLL button until “D/R SW” appearson the screen.4. Press the INCREASE or DECREASE button untilthe desired switch position or “CF” for “VTR”appears on the screen. To adjust the dual ratevalues see Section 7.2.5. Press the SCROLL button to access the Ger/GyroSwitch Selection function.6. To exit, press the SCROLL and INCREASEbuttons simultaneously.The dual rate switch position is selectable and theelevator and aileron dual rates can be combined onone switch. This allows a single switch to be usedwhen moving from high rates for wild maneuvers tolow rates for mild maneuvers. Exponential Rate (EXP)is also available for both aileron and elevator andworks in conjunction with the dual rate function toprovide mild control movements around neutral whileallowing maximum servo travel. This reduces sensitivityin the middle portion of the stick control and stillallows full travel at the end of the stick control. Referto section 7.3 for exponential rate adjustment.DUAL RATE SWITCH SELECTION6.3CHANNELSCROLL INCREASEDECREASEENTERPress the SCROLL button until“D/R SW”appears on the screen. Press either the INCREASE or DECREASEbuttons until the desired switch positionappears on the screen.3984 JR XP662 Manual 1/21/02 1:11 PM Page 58
59XP662 MANUAL HelicopterAccessing the Gear/Gyro Switch Selection FunctionGERFINDICATES GEAR/GYROSWITCH SELCTION FUNCTIONH : HOLD SWITCHA : AILERON DUAL RATE SWITCHE : ELEVATOR DUAL RATE SWITCHF : FLIGHT MODE SWITCH CHAPTER 6:FUNCTIONS (SYSTEM MODE) • HelicopterThe XP662 gear/gyro switch selection functionenables the dual rate values of the gyro to becombined with one of four switches (flight mode,throttle hold, aileron dual rate, elevator dual rate).This feature is for use with gyros that offer a dual ratesensitivity adjustment, such as the JR G460T PiezoGyro (JRPG460T). The most common use for thisfeature would be to combine the gyro dual rateadjustment with the flight mode switch. This wouldthen automatically alter the gyro sensitivity fromnormal (hover) to flight (forward flight) when theflight mode switch is in use.1. Press the SCROLL and INCREASE buttonssimultaneously and hold.2. Turn on the transmitter to enter the system mode. 3. Press the SCROLL button until “GER” appears onthe screen.4. Press the INCREASE or DECREASE button toselect the switch you prefer to use for theoperation of the gyro sensitivity.5. Press the SCROLL button to access the ModelSelection function.6. To exit, press the SCROLL and INCREASEbuttons simultaneously.Note: The remote gain lead from the gyro should beplugged into channel 5 (gear) of the reciever.GEAR/GYRO SWITCH SELECTION6.4CHANNELSCROLL INCREASEDECREASEENTERPress the SCROLL button until“GER”appears on the screen. Press either the INCREASE or DECREASEbuttons to select the switch you prefer to usefor the operation of the gyro sensitivity.3984 JR XP662 Manual 1/21/02 1:11 PM Page 59
60 XP662 MANUAL HelicopterCHAPTER 6:FUNCTIONS (SYSTEM MODE) • HelicopterAccessing the Model Selection FunctionIMDL INDICATES MODEL SELECTION FUNCTIONMODEL NUMBER 1 OR 2The XP662 has memory for six models. It can storethe settings for six airplanes, six helicopters or threeairplanes and three helicopters, etc.1. Press the SCROLL and INCREASE buttons simultaneously and hold.2. Turn on the transmitter to enter the System mode. 3. Press the SCROLL button until “MDL” appears on the screen.4. Press the INCREASE or DECREASE button toselect model numbers 1 through 6.5. Press the SCROLL button to access the ModelName entry function.6. To exit, press the SCROLL and INCREASE buttons simultaneously.MODEL SELECTION6.51 THROUGH 6MCHANNELSCROLL INCREASEDECREASEENTERPress the SCROLL button until“MDL”appears on the screen. Press the INCREASE or DECREASE buttonsto select model number 1 through 6.3984 JR XP662 Manual 1/21/02 1:11 PM Page 60
61XP662 MANUAL HelicopterCHAPTER 6:FUNCTIONS (SYSTEM MODE) • Helicopter1. Press the SCROLL and INCREASE buttonssimultaneously and hold.2. Turn on the transmitter to enter the System mode.3. Press the SCROLL button until “AC1” appears on the screen.4. Press the INCREASE or DECREASE buttons toselect the correct letter/number for the first character (flashing).5. To adjust the remaining two characters, press the CHANNEL button until the desired character to beadjusted is flashing.6. Press the SCROLL button to access theModulation Select function.7. To exit, press the SCROLL and INCREASEbuttons simultaneously.Accessing the Model Name Entry FunctionThe XP662 allows a 3-digit name to be input for eachof the six models available. The current model willbe displayed in the normal display. This feature isuseful to help identifydifferent aircraft types, ormodel setups.MODEL NAME ENTRY6.6IHEIFLASHING INDICATESCHARACTER TO BE ADJUSTEDCURRENT MODEL NUMBERPress the CHANNELbutton to select thecharacter to bechanged (flashing).Press the INCREASE orDECREASE buttons toselect the desiredcharacter (A-Z, 1-9, etc.).In System Setup mode,press the SCROLL buttonuntil “MD1”appears on the screen.CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 61
62 XP662 MANUAL Helicopter1. Press the SCROLL and INCREASE buttonssimultaneously and hold.2. Turn on the transmitter to enter the System mode.3. Press the SCROLL button until “PPM” appears onthe screen.4. Press either the INCREASE or DECREASEbuttons to change the modulation to the desiredsetting FM (PPM), Z-PCM (ZPC) or S-PCM (SPC).*5. Press the SCROLL button to access the Model Type function.6. To exit, press the SCROLL and INCREASE buttons simultaneously.Accessing the Modulation Select FunctionCURRENTMODULATION TYPEIPPMCURRENT MODELNUMBERMODULATION TYPESPPM (FM)SPCMZPCMThe modulation select function enables your XP662to transmit to a variety of JR receivers that arealready, or may soon be, in existence. You can selectfrom either PPM (FM), Z-PCM or S-PCM,dependingon the central processing unit within your receiver toutilize existing receivers, or to upgrade your XP662flight pack for future models. Your system comesfactory preset in the FM or PPM (Pulse PositionModulation) position so that it is compatible withthe included R700 FM receiver.Please refer to the receiver compatibility chart below when selecting the modulation type forvarious JR receivers.Note: Once the proper modulation has beenselected for a specific model number, the modulationtype will remain the same for that model number,even during model number/type changes. In otherwords, if you have one model on FM/PPM and onemodel on PCM, the system will automatically changemodulation types once the correct modulation hasbeen selected for that model.MODULATION SELECT6.7TX Modulation Compatible Receivers # of Channels & Brief DescriptionPPM (FM) NER-226 6 (micro)PPM (FM) NER-228 8PPM (FM) NER-327x 7PPM (FM) NER-527x 7 (micro)PPM (FM) NER-529x 9 (micro)PPM (FM) NER-549 9PPM (FM) NER-600 6 (micro)PPM (FM) NER-700 7 (Slimline)TX Modulation Compatible Receivers # of Channels & Brief DescriptionZ-PCM NER-236 6 (micro)Z-PCM NER-627XZ or627 “G” series7Z-PCM NER-J329P 9Z-PCM NER-910XZ 10S-PCM NER-D940S 10S-PCM NER-649S 9S-PCM NER-950S 10CHAPTER 6:FUNCTIONS (SYSTEM MODE) • HelicopterCHANNELSCROLL INCREASEDECREASEENTERPress the INCREASE orDECREASE buttons to selectthe desired modulation.Note: The modulation for the current model in use can be viewed at a glance by pressing the mode button with the system in the normalscreen position.Press the SCROLL buttonuntil “PPM”appears.Note: If either S-PCM or Z-PCM modulation is selected, pressingthe SCROLL button will access the Fail-Safe/Hold function.3984 JR XP662 Manual 1/21/02 1:11 PM Page 62
When the Fail-Safe function is activated (i.e., whenthe signal is interrupted), the transmitter automaticallymoves each servo to a preset position. The positionthat each servo assumes is determined by you, as isthe time length of interference that must occurbefore servo movement.After the interference has ceased, control of theairplane returns immediately to you.There are three time delays to choose from: 1/3 (0.3)second, 1/2(0.5) second and 1.0 second. These timedelays are the amount of time it takes, starting themoment the interference occurs, until the servosassume their preset positions.1. Press the SCROLL and INCREASE buttonssimultaneously and hold.2. Turn on the transmitter to enter the System mode.3. Press the SCROLL button until “FST” appears onthe screen.Note: If “Fail-Safe” does not appear on your LCD, itis because you are transmitting in PPM. Fail-Safe isnot applicable in the PPM mode. Refer to theModulation Mode Selection section for more information.63XP662 MANUAL HelicopterFAIL-SAFE/HOLD FUNCTION IN Z-PCM MODULATION6.9The Hold function is automatically activated whenthe radio is turned on and is in the Z-PCM modulation.This function stops (or holds) the servos in thepositions they were in just prior to the interference.Therefore, your airplane maintains the position heldimmediately before the interference was experienced.When a clear signal is restored, the Hold functionreleases, and control of the airplane returns to you.If you would prefer your control surfaces to move toa chosen position during a loss of signal, please referto the time delay/memory section below.Hold (Z-PCM)Accessing Fail-Safe/Hold (Z-PCM)The Fail-Safe/Hold function is available only whenyou use the XP662 transmitter in either of thePCM modulations: S-PCM or Z-PCM. This function isdesigned to help minimize damage to your airplaneduring a loss of signal to the receiver. The servoseither assume the fail-safe presets or hold the lastgood signal position.Note: In the PCM modulations, the Fail-Safe/Holdfunction cannot be totally disabled so that theservos will react to interference in the same way asthey do in a PPM system. This is only possible withthe use of a PPM receiver and the transmitter in thePPM modulation.Note: Since the actual screen appearance varies,depending on the modulation of your radio, referto the appropriate modulation section which follows(Z-PCM, S-PCM).As noted earlier, if you are in the PPM modulation,the Fail-Safe/Hold function is not applicable.Therefore, the Fail-Safe/Hold function will not appearon your LCD in the PPM mode.Refer to the Modulation Selection section for moreinformation pertaining to the broadcast signal ofyour XP662 transmitter.FAIL-SAFE/HOLD6.8CHAPTER 6:FUNCTIONS (SYSTEM MODE) • Helicopter3984 JR XP662 Manual 1/21/02 1:11 PM Page 63
64 XP662 MANUAL HelicopterHO = ALL SERVOS HOLD0.3 = 1/3 SECOND TIME DELAY0.5 = 1/2 SECOND TIME DELAY1.0 = 1 SECOND TIME DELAYHOFSTPress either the INCREASE orDECREASE buttons to select thedesired time delay.HOLD.3 SECONDS.5 SECONDS1.0 SECONDS1. After accessing the Fail-Safe function, it is now time to adjust the fail-safe time presets.2. Select among the three time delays (.3, .5, or 1.0 seconds) by pressing either the (+) or (-) keysuntil the desired setting appears on the screen.CHAPTER 6:FUNCTIONS (SYSTEM MODE) • Helicopter1. Press the SCROLL button until FSM appears onthe screen.Note: If Hold position (HO) is selected, thisfunction/screen will not be present.2. Set all controls to the desired fail-safe position, then press the (+) and (-) buttons simultaneously.A high pitch beep sound will confirm that thepreset positions have been entered.3. Hold the transmitter sticks in the position that you want the servos to assume during signal lossconditions. You can determine fail-safe preset positions for the other channels by placing the potentiometers and switches in the positionsthat you want them to assume during interference.4. With the sticks, switches and potentiometers in the fail-safe positions, press the CHANNEL andINCREASE keys simultaneously. This will enterthese locations as the fail-safe memory settings.A high-pitched beep will indicate that thissetting has been stored.5. To confirm that the input of data was successful, switch the transmitter OFF. The controls will moveto the input locations. If not, repeat Step 4 again.6. To exit the Fail-Safe function, press the SCROLL and INCREASE buttons simultaneously.Note: These preset positions remain stored in thetransmitter’s memory until both the transmitterbattery pack and the lithium back-up battery havebeen removed (or until data reset has been performed).Therefore, you do not have to reset the fail-safe eachtime you fly. Should you want to re-adjust the fail-safe presets, access the Fail-Safe function and adjustthe presets as you have just done. The transmitterautomatically recalls the settings for the last fail-safe adjustment.CL WILL FLASH WHEN FAIL-SAFE SERVO POSITIONS AREENTERED.CLFSMPress the CHANNEL and INCREASE buttonssimultaneously to store the fail-safe servo presets.FAIL-SAFE/HOLD FUNCTION IN Z-PCM MODULATION (continued)6.9Setting Servo Position PresetsSetting Fail-Safe/Hold Time Delay/Memory In Z-PCM ModulationCHANNELSCROLL INCREASEDECREASEENTERCHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 64
65XP662 MANUAL HelicopterCHAPTER 6:FUNCTIONS (SYSTEM MODE) • HelicopterThe Hold function is automatically activated whenthe radio is turned on and in the S-PCM modulation.This function stops (or holds) the servos in thepositions they were in just prior to the interference.Therefore, your aircraft maintains the position heldimmediately before the interference was experienced.When a clear signal is restored, the hold functionreleases, and control of the airplane returns to you.The XP662 allows you to combine the hold and fail-safe presets for all six channels on the receiver youcan select fail-safe or hold independently for allchannels on your aircraft. In other words, somechannels will hold their last clear signal position,while others assume the preset position. Once thefail-safe has been activated by signal interruption(interference), the transmitter automatically movesthe servos to a preset position. The predeterminedservo positions are set byyou. In the S-PCM fail-safe,the time delay (the amount of time it takes, startingthe moment the interference occurs, until the servosassume the preset positions) is fixed at .3, or 1/3, second.After the interference has ceased, normal operationof the airplane returns to you immediately.Hold Function (S-PCM)FAIL-SAFE/HOLD MEMORY IN S-PCM MODULATION6.10Fail-Safe/Hold Combination in S-PCM Modulation3984 JR XP662 Manual 1/21/02 1:11 PM Page 65
66 XP662 MANUAL Helicopter1. Press the SCROLL button until “FSM” appears on the screen.2. Set all controls to the desired Fail-Safe positions.Next press the CBHANNEL and INCREASEbutton simultaneously. A high-pitch beep soundwill confirm that the preset positions have beenentered and accepted.SERVO PRESET MEMORYCL WILL FLASH WHEN FAIL-SAFE SERVO POSITIONSARE ENTERED.CLFSMPress the CHANNEL and INCREASEbuttons simultaneously to store thedesired fail-safe presets/positions.Press the SCROLL and INCREASE buttonssimultaneously to exit the function mode.FAIL-SAFE/HOLD MEMORY IN S-PCM MODULATION (continued)6.10Setting Servo Fail-Safe Presets in S-PCM ModulationPress the INCREASE orDECREASE buttons to activate thepreset position function.Press the CHANNELbutton to accesschannels 1-6.1. Press the SCROLL and INCREASE buttons simultaneously and hold.2. Turn on the transmitter to enter the system mode.3. Press the SCROLL button until “FS1” appears onthe screen. The #1 on the screen refers to thespecific channel (1-6) to be adjusted.4. Press the INCREASE or DECREASE button toactivate (turn on) the preset position function forthat channel.5. Press the CHANNEL button to move to the next channel(s) to be adjusted (2-6). Repeat Step 4 foreach channel to be activated.Note: If Hold Position (HO) is selected for all sixchannels, this Function/Screen will not be present.Activating Servo Fail-Safe Presets by Channel (S-PCM)CHAPTER 6:FUNCTIONS (SYSTEM MODE) • HelicopterCHANNELSCROLL INCREASEDECREASEENTERFAIL-SAFECURRENT CHANNELOF = HOLDCh = PRESET SERVOPOSITION OFFS2CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 66
67XP662 MANUAL HelicopterAccessing the Servo Reversing FunctionTHR : THROTTLEAIL : AILERONELE : ELEVATORRUD: RUDDERGER: GEAR/GYROPIT : PITCH (HE ONLY)CHANNEL123456REV◆NORMTHR–+MODEENTERCHANNEL INCREASECLEARDECREASEPress the INCREASE or DECREASEbutton to change the servo direction.Press the MODEbutton untilREV◆NORMappears on thescreen.Press theCHANNEL buttonuntil the desiredchannel appearson the screen.Left RightHigh Pitch / ThrottleLow Pitch / Throttle Left RightBackForwardForwardBackLeft Stick Direction (Mode II)Left (Tail Rotor)Up (More Pitch)Down (Less Pitch)Right (Tail Rotor)Right Stick Direction (Mode II)Left (Aileron)Forward (Elevator)Back (Elevator)Right (Aileron)Servo reversing is a very convenient function used inthe setup of a new aircraft. It is used to change thedirection of servo rotation in relation to thecorresponding stick movement. Servo reversing isavailable for all six channels.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the Function mode.3. Press the SCROLL button until “REV-NORM”appears on the screen.4. Press the CHANNEL button until the desiredchannel appears on the screen.5. Press the INCREASE or DECREASE button to change the servo direction.6. Press the MODE button to access the Dual Rate function.7. To exit, press the MODE and CHANNEL buttons simultaneously.SERVO REVERSING7.1CHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterCHANNELSCROLL INCREASEDECREASEENTERPress the INCREASE orDECREASE button to changethe servo direction.Press the CHANNEL buttonuntil the desired channelappears on the screen.Press the SCROLL buttonuntil “REV/NORM”appearson the screen.3984 JR XP662 Manual 1/21/02 1:11 PM Page 67
68 XP662 MANUAL HelicopterCHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterSWITCH POSITION (0 OR 1)DUAL RATE VALUE (0-125%)D/R AIOI00%INDICATES THE DUAL RATE FUNCTIONCHANNELAI : AILERONEL : ELEVATORAccessing the Dual Rate FunctionDual rate is available for the aileron and elevatorchannels. The purpose of this function is to allow forin-flight selection of two preset servo travels for eachof these channels. The amount of travel is adjustablefrom 0-125%. The factory settings for both switchpositions (0 and 1) is 100%. Either position may beselected as the low or high rate by placing theswitches in the desired position and adjusting thevalue for that position. Operation of these switchesis described in Section 6.3.Different types of maneuvers require varyingamounts of control movements. Snap rolls requirelarge control movements, while smooth maneuverslike long slow rolls are best performed with smallercontrol movements. Dual rates allow you to changethe control movements in flight at the flip of aswitch. This allows you to execute maneuversrequiring both radical control movements and smallcontrol movements during a single flight.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.3. Press the SCROLL button until “D/R” appears on the screen.4. Press the CHANNEL button until the desiredchannel appears on the screen (AI = aileron or EL = elevator).5. The number that appears directly to the right ofthe selected channel is the switch position. Thereare two switch positions, 0 and 1, for each of thechannels. A “0” will appear when the selected dualrate switch is in the uppermost position and a “1”when the selected switch is in the lower position. 6. To change the switch selection you must enterthe dual rate switch selection function in thesystem mode (see Section 6.3).7. The number in the center of the screen indicatesthe current dual rate value for the selectedswitch position and channel. Press theINCREASE or DECREASE button to adjust thedual rate value (0–125%).8. After adjusting the value for the 0 switch position,change to the 1 switch position and adjust the rates.9. Press the CHANNEL button to select the otherchannel and adjust the dual rate value for bothswitch positions.10. Press the SCROLL button to access theexponential rate feature.11. To exit, press the SCROLL and INCREASE buttons simultaneously.DUAL RATE7.2CHANNELSCROLL INCREASEDECREASEENTERPress the SCROLL button until“D/R”appears on the screen.Press the CHANNEL button until“AI”or “EL”appears on the screen.Press the INCREASE or DECREASEbutton to adjust the dual rate value.3984 JR XP662 Manual 1/21/02 1:11 PM Page 68
69XP662 MANUAL HelicopterCHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterProgrammable exponential adjustments are offeredon the aileron and elevator channels of your XP662system. Exponential is a function that allows you totailor the response rate of the controls as comparedto the stick inputs. The purpose of exponential is toreduce the sensitivity in the middle portion of stickmovement, while still allowing full travel at the endof the stick movement. In other words, the end result(travel) remains the same, although exponentialchanges the rate at which it achieves this travel.The adjustable range of the Exponential function isfrom 0–100%. Zero percent (0%) is linear stickcontrol which means that the response rate is equalthroughout the stick control. One hundred percent(100%) is full exponential. The larger the exponentialvalue, the less servo action, or sensitivity, you willnotice around the neutral setting.Note: The Exponential function operates inconjunction with the Dual Rate function. It isimperative to understand the Dual Rate Functionprior to adjusting the exponential values.Exponential may be selected independently foreither the high or low rate (position 0 or 1) or both.EXPONENTIAL7.3Accessing the Exponential Function1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the Function mode.3. Press the SCROLL button until “EXP” appears atthe left side of the screen.4. Press the CHANNEL button until the desired channel appears on the screen (AI or EL).5. Using the appropriate dual rate switch, select the correct position to be adjusted (0 or 1).6. Press the INCREASE or DECREASE buttons toincrease/decrease the exponential value.7. Press the SCROLL button to access the Sub-Trim function.8. To exit, press the SCROLL and INCREASEbuttons simultaneously.SWITCH POSITIONAI = AILERONEL = ELEVATOREXPONENTIAL VALUE0%AIOPress the INCREASE orDECREASE buttons toincrease/decrease theexponential valve (0–100%).Press the SCROLL buttonuntil “EXP”appears on theleft side of the screen.Note: The dual rate switch position ischanged/ accessed by setting the appropriatedual rate switch to the 0 or 1 positions.Press the CHANNEL buttonto select either aileron orelevator exponential.EXPA good starting pointfor exponential valve isapproximately 20–30%.CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 69
70 XP662 MANUAL HelicopterAccessing the Sub-Trim FunctionSB-TRIM THR0THR : THROTTLEAIL : AILERONELE : ELEVATORRUD: RUDDERGER: GEAR/GYROPIT : PITCH (HE ONLY)CHANNEL123456INDICATES THE SUB-TRIM FUNCTIONSUB-TRIM VALUE (±125)Sub-trim is an electronic trim that is available foreach of the six channels. Sub-trim is particularlyuseful as it allows the mechanical trim levers to bereturned to their neutral positions by adjusting/changing the servo’s neutral position electronically,without the need to mechanically adjust the specificcontrol linkage. This allows the same mechanicaltrim lever settings between the five models you cancontrol with this radio system. Sub-trim can alsoallow additional trim travel when mechanical trimsdo not provide enough movement.Note: It is recommended to use as little subtrim aspossible for adjustment. If more that 20–30 pointsare required, is it suggested that a mechanicallinkage adjustment be performed.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.3. Press the SCROLL button until “SB-Trim”appears on the screen.4. Press the CHANNEL button until the desiredchannel appears on the screen.5. Press the INCREASE or DECREASE button toestablish the desired amount of sub-trim.6. Press the SCROLL button to access the TravelAdjustment function.7. To exit, press the SCROLL and INCREASE buttons simultaneously.SUB-TRIM7.4CHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterPress the SCROLLbutton until “SB-TRIM”appears on the screen.Press the CHANNEL buttonuntil the desired channelappears on the screen.Press the INCREASE orDECREASE button toadjust the sub-trim value.CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 70
71XP662 MANUAL HelicopterCHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterTRV ADJ. THR+I00%THR : THROTTLEAIL : AILERONELE : ELEVATORRUD: RUDDERGER: GEAR/GYROPIT : PITCH (HE ONLY)CHANNEL123456INDICATES THE TRAVELADJUSTMENT FUNCTIONTRAVEL ADJUSTMENT VALUESERVO OPERATING DIRECTIONAccessing the Travel Adjustment FunctionThe amount of servo travel is adjustable for eachdirection for each of the 6 channels individually. The adjustment range is from 0% to 150%. Traveladjustment is factory set at 100% for all channels.The travel adjustment value displayed on the screendepends on the position of the stick or switch (e.g.,flap switch, gear switch). This function is usefuleither to maximize control surface travel or to reducetravel to eliminate servo binding without the needfor mechanical adjustment. This function is also used to remove unwanted pitch-to-cyclic coupling when in CCPM Swashplate Mixmode (see page 84).1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttons simultaneously to enter the function mode.3. Press the SCROLL button until “TRV ADJ.”appears on the screen.4. Press the CHANNEL button until the desiredchannel appears on the screen.5. Move the selected channel stick or switch in thedirection that you want to adjust the travel. Pressthe INCREASE or DECREASE button to achieve the desired travel. Move the stick in the opposite direction to adjust the travel in theopposite direction.6. The same may be done for all channels.7. Press the SCROLL button to access the throttlehold function.8. To exit, press the SCROLL and INCREASE buttons simultaneously.TRAVEL ADJUSTMENT7.5Press the SCROLLbutton until “TRV ADJ.”appears on the screen.Press the CHANNEL buttonuntil the desired channelappears on the screen.Press the INCREASE orDECREASE button to adjustthe travel adjustment value.CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 71
72 XP662 MANUAL HelicopterAccessing the Throttle Hold FunctionINDICATES THE THROTTLE HOLD FUNCTION“HLD” will flash when the throttle hold switch is onand the function is activated.THROTTLE HOLD VALUE (-20%–50%)OF = OFFHLD–5%The throttle hold function enables the throttle servoto be held in a specific location, while allowing thecollective pitch servo to move independently withthe throttle stick. The purpose of this function is forpracticing autorotation landings with the helicopter’sengine at idle. When the throttle hold switch ischanged from off to activated, there will be a thirdadjustable pitch curve added to the pitch curvefunction. The throttle hold switch is located on thetop right rear corner of the transmitter. The throttlehold is on in the forward position. In the backposition, the throttle hold function is off.1. Turn on the transmitter.2. Press the SCROLL and INSREASE buttonssimultaneously to enter the Function mode.3. Press the SCROLL button until “HLD” appears on the screen.4. The factory setting for the Throttle Hold function is off.Note: When the Throttle Hold function is off, thethrottle hold pitch curve will not appear in thepitch curve function. Press the INCREASE or DECREASE button toactivate the Throttle Hold function. The throttlehold pitch curve will now appear in the pitchcurve function. To inhibit the Throttle Holdfunction, press the CHANNEL and INCREASEbuttons simultaneously.5. Using the INCREASE or DECREASE button,adjust the throttle hold value to deliver a reliableengine idle speed. To do this, set the throttletrim to your normal starting idle setting (1/2, 3/4,etc.). Next, with the engine off, adjust yourthrottle hold value so that, when you change thethrottle hold from on to off, there is no movementof the servo arm. The normal range of throttlehold is from -2 (1/2 trim)to +15 (full high trim).6. Press the SCROLL button to access the pitch curve function.7. To exit, press the SCROLL and INCREASE buttons simultaneously.THROTTLE HOLD7.6CHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterPress the INCREASE or DECREASEbutton to activate the throttle holdfunction and to adjust the value.Press the SCROLLbutton until “HLD”appears on the screen.CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 72
Press the SCROLL buttonuntil “PLN”appears onthe screen. Press again toaccess Stunt, Hold orThrottle Curve.Press the CHANNEL buttonto select the desired pointdisplay/stick position.Press the INCREASE orDECREASE button toadjust the pitch curve value.73XP662 MANUAL HelicopterCHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterAccessing the Pitch Curve FunctionPLNPITCH CURVELOW STICKNORMAL MODEP2NPITCH CURVEHALF STICKNORMAL MODEPHNPITCH CURVEHIGH STICKNORMAL MODEPLSPITCH CURVELOW STICKSTUNT MODEP2SPITCH CURVEHALF STICKSTUNT MODEPHSPITCH CURVEHIGH STICK STUNTMODE100%50%0%L2THROTTLE/PITCHSTICK LOCATIONNORMALSTUNTHOLDOUTPUT VALUEHPITCH CURVE VALUE (0-100%)PLN0%SWITCH POSITIONFlashing when switch position and display are the same.N: NORMALS : STUNTH: HOLD Only visible when hold function is activated.POINT DISPLAY/STICK POSITIONL : LOW 0%2 : CENTER 50%H: HIGH 100%The XP652 offers three separate pitch curves with three adjustable reference points per curve. Thisfunction allocates a separate pitch curve settingduring Normal, Stunt, and Throttle Hold modes tomaximize flight performance. Once the pitch curvesare established, each can be activated in flight using the two-position flight mode switch and the throttlehold switch.Each of the three reference points of the pitch curve are independently adjustable from 0–100%. These three points correspond to the low, middle, and highpositions of the throttle stick (collective).The graph below shows samples of pitch curves inthe Normal (N), Stunt (S) and Throttle Hold (H)conditions. The factory preset values for all threepitch curves are: Low 0%, Middle 50%, and High 100%.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttonssimultaneously to enter the Function mode.3. Press the SCROLL button until “PLN” appears onthe screen. The letter to the far right indicatesthe specific pitch curve section that you are in(N, S or H). The letter in the center indicates thereference point that you are in (L, 2 or H).4. Press the CHANNEL button to select the referencepoint of the pitch curve you want to change.5. Press the INCREASE or DECREASE button tochange the value of the current reference point.The range of each point is 0–100% in 1% intervals.6. To set the pitch curve for the stunt (flight) mode,press the MODE button once. Repeat Step 5 andStep 6 to adjust.7. To set the pitch curve for the throttle hold mode,press the MODE button once. Repeat Step 5 andStep 6 to adjust.8. Press the MODE button to access the throttlecurve function. Note: If throttle hold is not activated, theThrottle Curve function will be accessed.9. To exit, press the MODE and CHANNEL buttons simultaneously.PITCH CURVE7.7NNNNCHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:11 PM Page 73
74 XP662 MANUAL HelicopterAccessing the Throttle Curve FunctionAdjustment of the throttle curve is very similar to the pitch curve adjustment described in thepreceding section. A thorough understanding of thepitch curve section will make the throttle curvesection easier to understand.There are two independent types of throttle curvesavailable—normal and stunt. The normal or hoverthrottle curve has three reference points (L,2, H) and the stunt or flight throttle curve has two referencepoints (L and 2).The two throttle curves are activated by the flightmode switch located on the top left rear corner of the transmitter. The throttle curve is in the normalcondition when the flight mode switch is in the backposition. The throttle curve is in the stunt conditionwhen the flight mode switch is in the forward position.Note: In Stunt mode (S), the high position of thethrottle curve is preset to 100%, and is not adjustable.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttonssimultaneously to enter the function mode.3. Press the SCROLL button until “TLN” appears onthe screen. The letter to the far right indicatesthe specific throttle curve section that you are in(N, S, or H). The letter in the center indicates thereference point that you are in.4. Press the CHANNEL button to select thereference point of the throttle curve you want tochange (L, 2, or H*).5. Press the INCREASE or DECREASE button tochange the value of the current reference point.The range of each point is 0–100% in 1% intervals.6. To set the throttle curve for the stunt (flight)mode, press the SCROLL button once. Then,repeat Steps 5 and 6 to adjust.7. Press the SCROLL button once to access theRevolution Mixing function.8. To exit, press the SCROLL and INCREASE buttons simultaneously.* Normal mode only.THROTTLE CURVE7.8CHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterTHROTTLE CURVE VALUE (0-100%)TLN0%SWITCH POSITIONFlashing when switch position and display are the sameN: NORMALS : STUNTH: HOLD Only visible when the hold function is activatedPOINT DISPLAY/STICK POSITIONL : LOW 0%2 : CENTER 50%H: HIGH 100%NPress the SCROLL button until“TLN”appears on the screen.Press again to access Stunt mode.Press the CHANNEL button toselect the desired pointdisplay/stick position.Press the INCREASE orDECREASE button to adjustthe throttle curve value.CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:12 PM Page 74
75XP662 MANUAL HelicopterCHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterThe Revolution Mixing function combines tail rotorinput with the throttle/collective function tocounteract the torque created by the main rotorblades. When properly adjusted, the helicopter willclimb and descend without a tendency to yaw ineither direction. Revolution mixing is for use withnon heading lock gyros only.Since the torque created by the main rotor bladesvaries with different throttle/pitch settings, it isnecessary for the tail rotor blades to change pitch atthe same time. The “U” or up mixing adjusts the tailrotor compensation from the mid to high throttlestick setting. The “D” or down mixing adjusts the tailrotor compensation from the mid to the low throttlestick setting.Thus, if you were to move the throttle from the lowto high positions, the tail rotor servo will move fromthe “D” to the “U” settings.Revolution Mixing Set-up ProcedureFirst, set up the helicopter so that it will maintain astable hover with the tail rotor trim in the centerposition. Next, bring the helicopter into a steadyvertical climb. The body of the helicopter will movein the opposite direction to the main rotor rotation.Increase the “U” or up mixing until the helicopterclimbs without the tendency to rotate. At a safe altitude,reduce the throttle. The helicopter will descend, andthe body will turn in the same direction as the mainrotor blades. Increase the “D” or down mixing untilthe helicopter descends without the tendency to rotate.1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttonssimultaneously to enter the Function mode.3. Press the SCROLL button until “RVU” appears onthe screen.4. Press the CHANNEL button to select the up ordown Mixing function.5. Press the INCREASE or DECREASE button toadjust the mixing value of the applicable function.Press the CHANNEL and INCREASE buttonssimultaneously to reset the mixing value to 0%. Tochange the mixing direction, press the CHANNELand INCREASE buttons simultaneously again.6. Press the SCROLL button to access theProgrammable Mix A function.7. To exit, press the SCROLL and INCREASE buttons simultaneously.Accessing the Revolution Mixing FunctionPress the INCREASE andDECREASE buttons simultaneously tochange the mixing direction.REVOLUTION MIXING VALUE (0-125%)MIX RVU–0%MIXING FUNCTIONU = UP Flashing when throttle/pitch stick is in the up positionD = DOWN Flashing when throttle/pitch stick is in the down positionINDICATES THE REVOLUTION MIXING FUNCTIONMIXING DIRECTION–= RIGHT MIXING+ = LEFT MIXINGREVOLUTION MIXING (Non-Heading Lock Gyros Only)7.9VPress the SCROLL buttonuntil “RVU”appears onthe screen. Press the CHANNEL buttonto select the up or downmixing function.Press the INCREASE orDECREASE button to adjustthe revolution mixing value.CHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:12 PM Page 75
76 XP662 MANUAL HelicopterThe XP662 in Helicopter mode offers one (1)programmable mix to be used for a number ofdifferent purposes. The functions allow mixing anyone channel to any other channel.The mix can remain on at all times or be switched offin flight using a number of different switches. (Referto Chart A). Each channel is identified by channelnumbers 1-6 (i.e., 2 = aileron, 4 = rudder, etc. —seeChart B) The channel appearing first is known as theMaster Channel or the channel to which you want tomix. The second channel is known as the SlaveChannel or the channel that is being mixed into theMaster Channel. For example, “ELEV-AILE” wouldindicate elevator-to-aileron mixing each time theelevator stick is moved, the elevator will deflect, andthe aileron will automatically move in the directionand to the value input. Mixing is proportional, sosmall inputs of the master channel will producesmall outputs of the slave channel. Eachprogrammable mix has a mixing “offset.” The purposeof the mixing offset is to redefine the neutralposition of the slave channel.The elevator-aileron mix mentioned above is mostcommonly used to help trim the helicopter for proper“loop tracking.” This type of mix should be used onlyby pilots who are comfortable with theirprogramming abilities with the XP662.PROGRAMMABLE MIXING (A)7.10Accessing the Programmable Mixing Function1. Turn on the transmitter2. Press the SCROLL and INCREASE buttonssimultaneously to enter the Function mode.3. Press the SCROLL button until “MIX A11” appearsat the top right corner of the screen. This isprogram mix A.MIX AONF1 FOHChart A Switch Selection SWITCH Always ONFlight Mode SwitchPosition 1 ONFlight Mode Switch Position O ONThrottle Hold SwitchFUNCTIONThrottleAileronElevatorRudderGearPitch (AUX1)Chart B Channel NumbersCHANNEL NUMBER 1234560%AIIPress the SCROLL buttonuntil “MIX A11”appears.MIXCHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterCURRENT MIX CHANNELSCHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:12 PM Page 76
77XP662 MANUAL HelicopterCHAPTER 7:FUNCTIONS (FUNCTION MODE) • Helicopter1. Press the Channel button once until “MIXASW” appears.2. Press the INCREASE or DECREASE button toselect the desired switch to be used to activate themixing or leave as on if a constant mix is desired. (Refer to Chart A on the preceding page for possiblemix/switch selections.)1. Press the CHANNEL button twice until “MIX ACH” appears on the screen.2. Press the INCREASE button to select the desired“Master Channel” (1-6).3. Press the DECREASE button to select the desired“slave channel” (1-6). Refer to Chart B on thepreceding page for channel number clarification.PROGRAMMABLE MIXING (A) (continued)6.2032ACHPress the CHANNEL buttonuntil “MIX A”Ch appears. Press DECREASE to selectSlave Channel desired.Press INCREASE to selectMaster Channel desired.MASTERCHANNELSLAVECHANNELMIXAssigning ChannelsONA5WPress the CHANNEL buttonuntil “MIX ASW’appears.Press the INCREASE or DECREASEbuttons to select the desired switch tobe activated (refer to Chart A onpreceding page).SWITCHCHOICESONF1FOHMIXSwitch SelectionCHANNELSCROLL INCREASEDECREASEENTERCHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:12 PM Page 77
78 XP662 MANUAL Helicopter1. Press the Channel button once until “Mix A” appears, with the mixing value located at the bottom of the screen.2. To set the slave channels mixing value, move andhold the master channel control stick to the direction to be adjusted (up/down—left/right), then press the INCREASE key to add positivemixing value or the DECREASE key to addnegative mixing value (+/–125%). When themaster channels stick is moved, the display willautomatically show the mixing value for thecurrent stick direction. Note: If a mix switch position other than on isselected, it will be necessary to move the selectedswitch to the on, or active, position to adjust themixing value. “OF” will appear on the screen if theselected mixing switch is in the off position.The purpose of the mixing offset feature is to redefinethe neutral position of the slave channel to be mixed.Any desired position may be selected for the offsetreference point. To set the offset position, place themaster channel’s stick to the desired position andpress either the INCREASE or DECREASE buttons. This position is now stored in the memory and itsoffset value from the neutral position of the masterchannel is indicated numerically on the LCD display.Then, the mixing value at the determined offsetposition is now set at 0.1. Press the CHANNEL button once until offset appears in the center of the screen.2. Place the master channel stick to the desired position of slave channel offset, then press eitherthe INCREASE or DECREASE button to store.3. Press the SCROLL button once to access theCCPM swashplate function.4. To exit the Function mode, press the SCROLLand INCREASE buttons simultaneously.Note: If a mix switch position other than on hasbeen selected, it will be necessary to move theselected switch to the on or active position to set theoffset value. “OF” will appear on the screen if theselected mixing switch is in the off position.PROGRAMMABLE MIXING (A) (continued)7.100%A32Press the CHANNELbutton once until “MIX A”and value % appearsPress either the INCREASE or DECREASEbuttons to increase/decrease mixing value.CURRENTMIXINGVALUEMIX0A32Press the CHANNELbutton until “OFFSET”appears on the screen.Press either the INCREASE orDECREASE buttons to save theoffset position.OFFSETMIXINGVALUEMIXOFFSETMixing Value AdjustmentMixing Offset AdjustmentAccessing the Offset FunctionCHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterCHANNELSCROLL INCREASEDECREASEENTERCHANNELSCROLL INCREASEDECREASEENTER3984 JR XP662 Manual 1/21/02 1:12 PM Page 78
79XP662 MANUAL HelicopterCCPM SWASHPLATE MIXING7.11CHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterThe CCPM Swashplate Mixing function (CyclicCollective Pitch Mixing) of the XP662 system isdesigned to allow the XP662 to be used in modelhelicopters that utilize a 120° CCPM-type swashplatecontrol system. CCPM is a type of pitch mixing wherethe three servos are connected directly to theswashplate of the helicopter and physically move bothin unison and independently for all changes in pitch/cyclic. Please refer to the diagram below for proper120° Three Servo-CCPM identification and connection.120°120°Fore/AftCh. 2 AileronCh. 6 PitchCh. 3 Elevator3 Servos – 120° TypeThree-Servo (120 degrees) CCPM MixingFront ofHelicopterNote: The CCPM SwashplateMixing function is designed foruse only with helicopters thatincoorporate the special 120°three-servo CCPM control system design. Use of the CCPMFunction in a non-CCPM-equipped model can result in anuncontrollable condition.OFCCPIndicates CCPM SwashplateMixing FunctionIndicates Current Condition: OF = OffON = OnIndicates Current CCPM MixValue ( 100)Indicates Current Channel:2 = Aileron3 = Elevator6 = PitchMIX+60%CP2MIXPlease refer to the helicopter manufacturer’s instructionsfor proper mixing values.Please also note that if controlsystem interaction exists (pitch to aileron, pitch toelevator movement, etc.), it will be necessary to alter thetravel adjust values for channels 2, 3, and 6 to correctthis situation. Please refer to page 71 of this manual forfurther information.Press the SCROLL button until“CCP”appears on the screen.Press the INCREASE key to activatethe CCPM Swashplate function (on).Once the CCPM “ON”position has beenselected, press theCHANNEL key to selectthe desired channelnumber to be adjusted.+-CHANNELSCROLL INCREASEDECREASEENTERPress the INCREASE orDECREASE buttons to adjust theCCPM mix value for each channel.3984 JR XP662 Manual 1/21/02 1:12 PM Page 79
80 XP662 MANUAL HelicopterCCPM SWASHPLATE MIXING (continued)7.11CHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterAccessing the CCPM Swashplate Mixing Function1. Turn on the transmitter.2. Press the SCROLL and INCREASE buttonssimultaneously to enter the function mode.3. Press the SCROLL button until “CCP” appears on the screen.4. Press the INCREASE button once to activate theCCPM Swashplate Mix function. The screen willthen move to the “CP2” screen, indicating that theCCPM function is now on.5. Press the CHANNEL button to select the desiredchannel number to be adjusted.6. Press the INCREASE or DECREASE buttons toselect the desired mixing value for each channel(+100).7. Press the SCROLL button once to access the servoreversing function.8. To exit, press the SCROLL and INCREASE buttons simultaneously.-(Right)(Front)(Left)The 120° CCPM system requires the use of threeservos to operate, Aileron, Elevator, and AUX 1(Pitch). The labeling of these servos can become quiteconfusing because with the CCPM function, the threeservos no longer work independently, but rather as ateam, and their functions are now combined. For thisreason, we will refer to the three servos in thefollowing manner:Aileron Servo: We will refer to this servo as the“Left” servo. The channel number for this servowhen using a JR radio is CH2.Elevator Servo: We will refer to this servo as the“Front” servo. The channel number for this servowhen using a JR radio is CH3.AUX 1 (Pitch) Servo: We will refer to this servo asthe “Right” servo. The channel number for thisservo when using a JR radio is CH6.Please refer to the CCPM connections chart below forclarification. For non-JR radios, please consult yourradio instructions for proper connection.G4605 GYRO (OPTIONAL)(JRPG460T)CCPM SERVO CONNECTIONS7.12G460T3984 JR XP662 Manual 1/21/02 1:12 PM Page 80
81XP662 MANUAL HelicopterHOW 120 CCPM WORKS7.13CHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterAs mentioned previously, 120° Three-Servo CCPMrelies on the radio’s special CCPM swashplate mixing,rather than a conventional mechanical mixer that isutilized to achieve the same results.The radio’s 120° Three-Servo CCPM functionautomatically mixes the three servos to provide thecorrect mixing inputs for aileron (roll), elevator(pitch), and collective. The following is an example ofhow each control input affects the servo’s movement:1. CollectiveWhen a collective pitch input is given, all threeservos (A, B, and C) move together in the samedirection, at equal amounts, to raise and lower theswashplate while keeping the swashplate level.During this function, all three servos travel at thesame value (100%) so that the swashplate canremain level during the increase and decrease inpitch. As mentioned, this mixing of the three servosis achieved through the radio’s CCPM program.2. Elevator (Pitch)When an elevator input is given, all three servosmust move to tilt the swashplate fore and aft, buttheir directions vary. The two rear servos (B and C)move together in the same direction, while thefront servo (A) moves in the opposite direction. Forexample, when an up elevator (back cyclic)command is given, the two rear servos (B and C)will move downward, while the front servo (A)moves upward so that the swashplate will tilt aft.During this function, the front servo (A) travels at100%, while the two rear servos (B and C) travel at50% (1/2 the travel value) of the front servo. Thisdifference in travel is necessary due to the fact thatthe position of the front control ball is two timesthe distance of the two rear control ball position asmeasured from the center of the swashplate. Asmentioned, this mixing of the three servos is alsoachieved through the radio’s CCPM program.3. Aileron (Roll) When an aileron (roll) input is given, the two rearservos (B and C) travel in opposite directions, whilethe front servo (A) remains motionless. Forexample, when a left aileron (roll) command isgiven, the left rear servo (C) will move downward,while the right rear servo (B) will move upward totilt the swashplate to the left. As mentioned, thefront servo (A) will remain motionless. The travelvalue for each of the two rear servos is 100%.Please refer to the diagram below for clarification.Front of HelicopterElevator Axis120° CCPM Control System3984 JR XP662 Manual 1/21/02 1:12 PM Page 81
82 XP662 MANUAL HelicopterHOW 120 CCPM WORKS (continued)7.13CHAPTER 7:FUNCTIONS (FUNCTION MODE) • HelicopterThe JR 120° CCPM or Cyclic/Collective Pitch Mixingsystem offers the user a control system that canaccomplish the same control inputs as the One-ServoStandard system, but with increased precision andreduced complexity.As with the One-Servo system, the JR CCPM systemutilizes three servos for the three main controls:aileron (roll), elevator (pitch) and collective. TheCCPM lower swashplate ring is designed with onlythree control balls, spaced at 120° from each other,hence the 120° CCPM designation. Although thecontrol balls are not at 90° as in the standard system,the aileron (roll) axis is still parallel to the mainmechanics of the helicopter, and the elevator (pitch)axis still functions at 90° to the mechanics as doesthe One-Servo System. Please refer to the diagrambelow for clarification. The main and important difference in the way thatthese two systems operate is that unlike the One-Servo system where the three servos work completelyindependent from each other, the CCPM systems workas a team to achieve the same control inputs. Forexample, if an aileron (roll) input is given, two servoswork together to move the swashplate left and right. Ifan elevator (pitch) input is given, all three servos worktogether to move the swashplate fore and aft. Forcollective, it’s also the strength of three servos thatwill move the swashplate up and down the main rotorshaft. With two to three servos working at the sametime during any given control input, servo torque ismaximized and servo centering is also increased. Inaddition to these benefits, CCPM achieves thesecontrol responses without the need for complexmechanical mixing systems that require many morecontrol rods and parts to set up.This amazing CCPM control is achieved throughspecial CCPM Swashplate Mixing that is pre-programmedinto many of today’s popular radio systems.Since the 120° CCPM function is pre-programmed,CCPM is no more complicated to set up than aconventional One-Servo Standard system. When youfactor in the reduced parts count and easyprogramming, CCPM is actually easier to set up andoperate than many conventional systems.Elevator Axis120°120°Three-Servo CCPM Control SystemAileron Axis120 Three-Servo CCPM Swashplate Mixing3984 JR XP662 Manual 1/21/02 1:12 PM Page 82
83XP662 MANUAL HelicopterCHAPTER 8:DATA SHEET • HelicopterEA • A • E • CFF • H • A • EData Sheet8D/R % %EXP % %D/R % %EXP % %CHANNEL THR (1) AIL (2) ELE (3) RUD (4) GER (5) PITCH (6)NORM NORM NORM NORM NORM NORM••••• •REV REV REV REV REV REVSUB-TRIM TRAVEL ADJUST + % + % + % + % + % + %(TRV ADJ.) - % - % - % - % - % - %FAIL-SAFE (S-PCM) REVERSE SW*FAIL-SAFE TIME (Z-PCM) AILE (AI) ELEV (EL)POS OPOS 1L 2 HNSNSHTHRO CURVE TLN, T2N, THN, TLS, T2SPITCH CURVEPLN, P2N, PHN, PLS, P2S, PHS, PLH, P2H, PHH% % %% % % DUAL RATE • EXPD/R SWGEAR SWREVO-MIX(RV)UP (U) %%DOWN (D)+–THRO HOLD(HLD) ON OFPROG. MIX ACHANNELMASTER SLAVE MIX SWITCH OFFSET +GAIN -GAINON • F1 • FO • HPOSITION±Modulation S-PCM • Z-PCM • PPM (FM)Model Number ______________________ Model Name ________________________ AIL (2) ELE (3) PITCH (6)CCPM MIXING ON • OFF+–%%%+–+–3984 JR XP662 Manual 1/21/02 1:12 PM Page 83
84 XP662 MANUAL Important InformationIMPORTANT INFORMATIONRadio controlled models are a great source ofpleasure. Unfortunately, they can also pose apotential hazard if not maintained and operatedproperly. It is imperative that you install your radiocontrol system correctly. Additionally, your level ofpiloting competency must be high enough to ensurethat you are able to control your aircraft under allconditions. If you are a newcomer to radio controlledflying, please seek help from an experienced pilot oryour local hobby shop.Listed below are some safety Dos and Don’ts thatmust be followed by all pilots: • Ensure that your batteries have been properlycharged prior to initial flight.• Keep track of the time that the system is turnedon so that you will have an idea of how long youcan safely operate your system.• Perform a ground range check prior to the initialflight of the day. See the “Daily Flight Checks”section below for information on how to do so.• Check all control surfaces prior to each takeoff. • Use frequency flags.• Do not fly your model near spectators, parkingareas, or at any other area that could result ininjury to people or damage of property.• Do not fly during adverse weather conditions.Poor visibility can cause disorientation and lossof control of your aircraft. Strong winds cancause similar problems.• Do not fly unless your frequency is clear. Warning: Only one transmitter at a time canoperate on a given frequency. If you turn on yourtransmitter while someone else is operating amodel on your frequency, both pilots will losecontrol of their models. Only one person can usea given frequency at a time. It does not matter if itis AM, FM, or PCM—only one frequency at a time.• Do not point the transmitter antenna directlytoward the model. The radiation pattern from thetip of the antenna is inherently low. • Do not take chances. If at any time during flightyou observe any erratic or abnormal operation,land immediately and do not resume flight untilthe cause of the problem has been ascertainedand corrected.1. Check the battery voltage on both the transmitterand the receiver battery packs. Do not fly below9.0 volts on the transmitter or below 4.7 volts on the receiver. To do so can cause a crash ofyour aircraft.Note: When you check these batteries, ensure thatyou have the polarities correct on your expandedscale voltmeter.2. Check all hardware (linkages, screws, nuts, bolts)prior to each day’s flight. Be sure that binding doesnot occur and that everything is properly secured.3. Ensure that all surfaces are moving in the proper manner.4. Perform a ground range check before each day’s flying session. The range check should beas follows:• Do not extend the transmitter antenna at thistime. Turn the transmitter on.• Turn the model on.• Slowly walk away from the model while movingthe control surfaces. The aircraft shouldfunction properly at a distance of 75 to 100 feet.5. Prior to starting your aircraft, turn off yourtransmitter then turn it back on. Do this eachtime you start your aircraft. If any criticalswitches are on without your knowledge, thetransmitter alarm will warn you.6. Ensure that all trim levers are in the proper location.7. Be sure that all servo pigtails and switch harnessplugs are secured in the receiver. Make sure that the switch harness moves completely inboth directions.GENERAL NOTES1DAILY FLIGHT CHECKS23984 JR XP662 Manual 1/21/02 1:12 PM Page 84
85XP662 MANUAL Important InformationIMPORTANT INFORMATIONWARRANTY COVERAGEREPAIR SERVICE INSTRUCTIONSYour new equipment is warranted to the originalpurchaser against manufacturer defects in materialand workmanship for one year from the date ofpurchase. During this period, Horizon Service Centerwill repair or replace, at our discretion, anycomponent that is found to be factory defective at nocost to the purchaser. This warranty is limited to theoriginal purchaser of the unit and is not transferable.This warranty does not apply to any unit which hasbeen improperly installed, mishandled, abused, ordamaged in a crash, or to any unit which has beenrepaired or altered by any unauthorized agencies.Under no circumstances will the buyer be entitled toconsequential or incidental damages. This limitedwarranty gives you specific legal rights; you also haveother rights which may vary from state to state. As withall fine electronic equipment, do not subject your unitto extreme temperatures, humidity or moisture. Donot leave it in direct sunlight for long periods of time.In the event that your equipment needs service,please follow the instructions listed below:1. Check all on/off switches to be sure they are off. This will speed the repair process of checking battery condition.2. Return your system components only (transmitter, receiver, servos, etc.). Do not return your system installed in a model car, boat, plane, etc.3. Use the original carton/packaging (molded foam container), or equivalent, to ship your unit. Do not use the carton itself as a shipping carton; youshould package the equipment carton within asturdy shipping container using additional packingmaterial to safeguard against damage duringtransit. Include complete name and addressinformation inside the carton, as well as clearlywriting it on the outer label/return address area.Ship your equipment fully insured and prepaid.Horizon Service Center is not responsible for anydamages incurred during shipping.4. Include detailed information explaining your operation of the equipment and problem(s) encountered. Provide an itemized list of equipmentenclosed and identify any particular area/functionwhich may better assist our technicians inaddressing your concerns. Date your correspondenceand include your name, mailing address, and aphone number where you can be reached duringthe business day.5. Warranty Repairs. To receive warranty service you must include a legible photocopy of your original dated sales receipt to verify your proof-of-purchase date. Providing that warranty conditions have been met, your radio will be repaired without charge.6. Normal Non-Warranty Repairs. Should your repair cost exceed 50% of the retail purchase cost, you will be provided with an estimate advising you of your options.Within your letter, advise us of the payment methodyou prefer to use. Horizon Service Center acceptsVISA or MasterCard, please include your cardnumber and expiration date.Mail your system to:Horizon Service Center4105 Fieldstone RoadChampaign, Illinois 61822(217) 355-9511www.horizonhobby.com343984 JR XP662 Manual 1/21/02 1:12 PM Page 85
86 XP662 MANUAL Important Information72MHz requires no special license to operate.50MHz requires the operator to have an FCC amateur radio license (Ham).CH.NO. FREQUENCY 15 72.090 16 72.110 17 72.130 18 72.150 19 72.170 20 72.190 21 72.210 22 72.230 23 72.250 24 72.270 25 72.290 26 72.310 27 72.330 28 72.350 29 72.370 30 72.390 31 72.410 32 72.430 33 72.450 34 72.470 35 72.490CH.NO. FREQUENCY 36 72.510 37 72.530 38 72.550 39 72.570 40 72.590 41 72.610 42 72.630 43 72.650 44 72.670 45 72.690 46 72.710 47 72.730 48 72.750 49 72.770 50 72.790 51 72.810 52 72.830 53 72.850 54 72.870 55 72.890 56 72.910 57 72.930 58 72.950 59 72.970 60 72.990CH.NO. FREQUENCY00 50.80001 50.82002 50.84003 50.86004 50.88005 50.90006 50.92007 50.94008 50.96009 50.98072MHz 50MHzFREQUENCY CHART572MHzIMPORTANT INFORMATION*Channels 11–14 are not availableTransmitter Crystal Replacement NoticeThe Federal Communications Commission (FFC) requires thatchanges in transmitter frequency must be performed only by anauthorized service technician (Horizon Service Center). Anytransmitter frequency change made by non-certified technicianmay result in a violation of the FCC rules.3984 JR XP662 Manual 1/21/02 1:12 PM Page 86
3984 JR XP662 Manual 1/21/02 1:12 PM Page 87
Distributed exclusively by Horizon Hobby, Inc. Champaign, IL 61822www.horizonhobby.com© 2002 Horizon Hobby, Inc.3984 JR XP662 Manual 1/21/02 1:12 PM Page 88

Navigation menu